KEGG   Cucurbita moschata (crookneck pumpkin): 111434616Help
Entry
111434616         CDS       T05248                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00562  Inositol phosphate metabolism
cmos01100  Metabolic pathways
cmos04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111434616
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111434616
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmos01009]
    111434616
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111434616
    3.1.3.48  protein-tyrosine-phosphatase
     111434616
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     111434616
Protein phosphatases and associated proteins [BR:cmos01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    111434616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 111434616
NCBI-ProteinID: XP_022927849
LinkDB All DBs
Position
Unknown
AA seq 612 aa AA seqDB search
MDPKSTDSPPSPTVHSSATKFPEVHPQAPASSGMDNVAREAPSKLSSSGITSWAKNLKIS
QPQSASPDATTENAGKSAFARFTSGFGLNLSPKSAAPNDSPDASSKPAQPSLVGSFTRGL
VDSSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYV
EGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPVQLII
SFCQSAYSWLKDDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIEYYNQRRCFD
GKGLVLPSQIRYVKYFERILTYFNGENPPGRSCVLRGFRLHRCPYWIRPSITVSDHNGVL
FSTKTHQRTKNLSPEDFWFTAPKKGIMVFALPGEPGLAELCGDFKVHFHDRQGDFYCWLN
TTMTENRKMLYTNDLDGFDKRKLPSPGFQVEVVLVDMLPNVDNTTKKLDESSGSKSSAVD
GSEVSDNQNRKSLTNEKDDVFSDSESEGGSAKSKDAASGSGSEASAVKTTSKSQMSATSS
DDVASLSHATKQVSLGDGGAKQAAPAASDRKGDGVKISDSLSEIPNSESEFKAMAADASV
FTFGDDEDYESE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaaatctactgattccccaccgtcacctactgttcattcctcggctactaaa
tttccagaagtacatcctcaggctcctgcttcctctggaatggataatgtggcacgtgag
gcaccatctaagctatcttcttctggcataacttcatgggctaagaacttgaaaatttct
caaccacagtcagcttcaccagatgccacgactgaaaatgctgggaagtcagcgtttgct
cgttttactagtggctttggcttgaatttatctccaaaatctgctgcacctaatgattcc
ccagatgcctcttctaaacctgcccaacccagtttggttggatcatttacaagagggttg
gttgactcttcaaagagtgctgtaaaggctgttcaagttaaagcgcgtcatgttgtctcc
caaaacaagcgaagataccaggaaggtggatttgatttggacatgacttatattactgaa
aatatcattgcaatgggcttccctgcgggtgacatgagctcagggttttttggatatgtt
gagggtttctacagaaaccatatggaagaagtcattaagttctttgaaacacatcacaag
ggaaaatacaaagtatacaatctttgttccgagaggctatatgatgcgtcattatttgaa
ggaaaggtggcttgttttccttttgatgaccataactgtcccccggttcaactgataata
tcattttgccaaagtgcgtattcatggttgaaggatgatatcgaaaatgttgtggttgtg
cattgcaaggcaggaatggcccggacaggcttgatgatttccagtcttcttctatttctg
aagttctttccaacggctgaagaatctattgaatactacaaccagagaaggtgtttcgat
ggcaaaggcctggtcttaccaagtcagattaggtatgtcaaatatttcgagcgtatttta
acctacttcaatggagaaaatcctcctggccgcagttgtgtacttagagggtttcgtctc
cacagatgtccatattggatcaggccttccattactgtatctgaccataatggtgttctg
ttctccactaaaacacatcaaagaaccaagaatctgtcgccagaagatttttggtttact
gcaccaaagaaggggataatggtattcgccttacccggggagcctggtctagctgagttg
tgcggggacttcaaggttcatttccatgatcgccaaggagatttctattgttggctaaac
acaaccatgaccgaaaatcggaaaatgctctacactaatgatcttgatgggttcgacaag
agaaaactgccttcccctggatttcaggtcgaggttgttctagtagatatgttgccgaac
gtggacaatacgaccaagaaattagatgaaagctcgggctcgaaatcttctgcagttgat
gggagtgaagtttctgataaccaaaacagaaaatcattaactaatgagaaagatgatgta
ttttctgacagtgaatcagaaggtggttctgcaaagagcaaggatgcagcatcaggttca
gggtctgaagcatcagctgtcaagacgacatctaaatctcaaatgagtgcgacttcatcc
gacgatgttgcgagtttatcacatgcgacaaagcaagtttccctgggagatggtggagct
aaacaggctgctccagcagccagtgaccgaaaaggtgatggagtcaaaatatctgattcc
ctctcagaaattccaaattcagaaagtgaattcaaggcaatggctgctgatgcttctgtt
ttcacatttggggacgacgaagactacgagagtgagtaa

DBGET integrated database retrieval system