KEGG   Cucurbita moschata (crookneck pumpkin): 111435915Help
Entry
111435915         CDS       T05248                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00020  Citrate cycle (TCA cycle)
cmos00190  Oxidative phosphorylation
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111435915
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111435915
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111435915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 111435915
NCBI-ProteinID: XP_022929290
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MWRCVSRGLRASSSSFSRKSSPNDHLRSHFSRFFSDSTAGRSSYTVVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCAC
AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNTEDGTLHRFQAA
STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPD
AVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGAKQKPLENDAG
EKTIAWLDKLRNANGSLPTSNIRLNMQRIMQNNAAVFRTQETLEEGCKLIDKTWESFHDV
KVKDRSLIWNTDLIETIELENLLINASITMHSAEARKESRGAHAREDFTTRDDENWMKHT
LGFWENEKVRLDYRPVHMNTLDDEMETIPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtttctcgtggccttcgcgcttcttcttcttccttttccaggaaatcg
tcgcctaatgatcacctcagatctcacttttctcgattcttctccgattcgacggcaggt
cgctcgtcatacactgtggttgatcacacatacgatgcggttgtggtaggagccggtggt
gcagggcttcgagctgctataggattgtcagaacatggatttaatactgcctgcattact
aagcttttcccaactcgatctcacactgttgcagctcagggaggtattaatgctgcactg
ggaaacatgactgaggatgattggaggtggcacatgtacgacactgtcaaggggagcgat
tggctaggtgatcaggatgccattcaatacatgtgtagagaagcaccaaaagcagttatt
gagcttgagaattatggacttccattttctcgtactgaagagggaaaaatatatcaacgt
gcatttggtggtcagagcctcgactttggaaagggtggacaggcatatcgttgtgcatgt
gctgcagaccgaacggggcatgctttattgcatactctctatggccaggctatgaagcat
aacacacaattttttgtggaatattttgctttggatcttttaatgaatagtgatggtagc
tgccagggagtgatagcattaaatacagaggatggtacactacatcggttccaagctgca
tcaacaattttagctactgggggttatggcagagcatatttctctgccacctctgctcat
acctgtactggagatggaaatgccatggttgcacgtgctgggcttccacttgaggatttg
gagtttgtgcagtttcatccaacaggaatatatggtgctggatgccttattactgaagga
tctcgtggtgaaggaggcattcttaggaacagtgaaggtgagcgctttatggaacgatat
gccccaacagcaaaggatcttgcatcaagggacgttgtctcaagatccatgacgatggaa
attcgggagggtcgtggtgtaggaccactgaaggaccacatctatcttcatttaaatcac
ttaccccctgaggtactgaaggagagacttccgggtatctcagaaactgctgccattttt
gctggcgttgatgttaccaaagagcccattccagtgttacctacagtgcattataatatg
ggtggaattccaactaatcatcatggagaggtagttacaatcaagggcaacgatccagat
gctgtaattccaggattgatggctgctggcgaggcagcttgtgcctcggttcatggtgcc
aataggcttggtgcaaattcgcttttggacattgttgtctttggacgagcttgtgcaaat
agggtagcagagatcagtaaaccaggggccaagcaaaagccgttggaaaatgatgctggt
gagaagacaattgcatggctagacaaattaaggaacgcaaatggttcacttcccacctca
aatattcggttgaacatgcaacgaattatgcaaaacaatgctgctgtcttccgaactcag
gagaccttggaagaaggttgcaaattaattgacaagacatgggagagtttccatgatgtg
aaggtcaaggacaggagtttaatatggaacactgatttgatcgagacaattgaattggaa
aatcttttgatcaatgcctctattaccatgcactctgctgaagccaggaaagagagcaga
ggagcacatgctcgtgaagatttcacaacaagagatgatgagaactggatgaagcacaca
ttgggattctgggagaatgagaaggtcaggctggactataggccagtgcacatgaacaca
ttggacgatgagatggaaacaatccctcccaaggcccgtgtatactga

DBGET integrated database retrieval system