KEGG   Cucurbita moschata (crookneck pumpkin): 111436009Help
Entry
111436009         CDS       T05248                                 

Definition
(RefSeq) uncharacterized protein LOC111436009
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00061  Fatty acid biosynthesis
cmos00780  Biotin metabolism
cmos01100  Metabolic pathways
cmos01212  Fatty acid metabolism
Module
cmos_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111436009
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    111436009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmos01004]
    111436009
Enzymes [BR:cmos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     111436009
Lipid biosynthesis proteins [BR:cmos01004]
 Fatty acid synthase
  Component type
   111436009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 111436009
NCBI-ProteinID: XP_022929435
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MAPTSTSLFSFTHTQCPDKPRSLLRPTPSVSLFRSASLSFPSNSLPTFRCSLNTAVHDAP
IEEKVDVPIEKKFPSFPTVMDINEIRNILPHRFPFLLVDRVIEYNPGVSAVAIKNVTIND
NFFPGHFPDRPIMPGVLMVEAMAQVGGLVMLQPEVGGSRDNFFFAGIDKVRFRKPVIAGD
TLVMRMTLVKLQKKFGIAKMEGKAYVGGEVVCEGEFLMAMGKEE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacttccacttctctcttctccttcacccatactcaatgcccggacaaaccc
agatcccttcttcgtcccacaccctctgtttccctcttcagatctgcttccctctctttt
ccctccaattcgcttcccactttccgctgttctctcaataccgccgtccacgacgcaccc
attgaagaaaaagtagatgttcccatcgaaaagaagtttccatcttttcccactgtgatg
gatatcaatgaaattcgtaatatcttgccccacaggttcccgtttcttttagtagataga
gtgatcgaatacaatcctggggtttccgctgttgctattaagaatgttaccatcaatgat
aacttctttccaggccacttccctgatagacccatcatgcctggtgttctcatggttgag
gcaatggctcaagtaggcggtctagttatgctgcaaccagaggtgggaggctcacgcgac
aacttcttcttcgctggaatcgacaaagtgaggttccgaaaacccgtgatcgcaggagac
acattggtgatgcgaatgactcttgtcaagttgcagaagaagttcggaattgccaaaatg
gaagggaaggcgtacgtcggaggcgaagtcgtgtgcgaaggtgagttcttgatggccatg
ggtaaagaagaatga

DBGET integrated database retrieval system