KEGG   Cucurbita moschata (crookneck pumpkin): 111441137
Entry
111441137         CDS       T05248                                 

Definition
(RefSeq) formin-like protein 11
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
SSDB
Motif
Pfam: FH2 Prominin
Other DBs
NCBI-GeneID: 111441137
NCBI-ProteinID: XP_022933840
LinkDB
Position
Unknown
AA seq 783 aa
MGCVVKCVFMIVIANSLLNAAESFNVEELERVSGEDESGGNRPLILERFRALLGLNQSPS
DLSPSPSPSPAEAARPVHTHKHSRPHQLRLHKSRPVYKSKRHEDARKRVRKILVAVLVST
GITILICIIAAFWVCKKFKIRTEEPAEKLSITSETGEKTAKQKSGFDLFDLSTHGMDVEE
HSVSSSGERVTPVKSCSSDEEESFHSCGDTNLSNVRLSNASESSSANVKTNSYSSEPNKP
LTSDQFHLTPSLCNSETKDVPSLAPPPPPPPPPPLRPSPVTYRSSFSLSSPFSTGSTSSS
ALLRSSSPAMSDSSSLSQIPWNDLPSPPNIAKPSLPSSTIPPPPCPPPSLKENACSFKAP
PPPPPSKLPQFMAFGKEGNLLPKLKPLHWDKVRAAPDRSMVWDKLRWSSFELDEEMIESL
FGYNQHGSMKNGDASNKTPSPSKHILEAKRLQNLTILLKALNLSAEQACEAIEQGTGLRL
RQLEALVKMVPTQEEQAKLLSYEGDIGEYGCTEKFVIAILRIPFAFQRVEAMLYRETFED
EVNHLRNSFSMLEEACKELRSSRLFLKLLEAVLKTGNRMNVGTSRGGAKAFKLDALLRLS
DVKGTDGKTSLLHFVVQEIIRSEGIRVSGSIMGKISQKNKSRTIEERENDYRRMGLDLVS
GLSTELHNVKRAATTDLKVLASATANLNEGMARLQELVLKELCGDERSGNFVSAMKGFLS
YVKKTMELVRKDEEGVMGSVREITEYFHGNVSKEETNPLRIFVIVRDFLGMLDNVCKSFK
IGS
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgggttgtgttgtgaagtgcgttttcatgattgtgattgctaattcactgttgaatgca
gcagagagcttcaatgtagaagagcttgagagagtttcaggggaagatgagagtggagga
aatagacctttaattctggagagattcagagctctacttggactcaatcaaagcccatca
gatctgtcgccttcgccgtctccatcaccagccgaggcagctcgtccagtgcacacccat
aaacattcccgccctcatcagcttcgcttgcacaagagccgaccagtctacaaatctaaa
agacatgaagatgcaagaaaaagagtcagaaaaattcttgttgcagttcttgtgtctaca
ggaatcaccattttgatatgcattattgctgccttctgggtctgcaagaagtttaaaatt
cgaacagaggaacccgcggagaagctttctataacgagtgaaacaggagagaagacagcc
aaacaaaaatctgggtttgatctgttcgatctcagtacgcatggaatggatgttgaagaa
cacagtgtttcctcatctggggagagagttactcctgttaaatcttgttcttctgatgag
gaggaatcattccattcttgtggggataccaatttgtcgaatgttcgtctttcaaatgct
tctgaatcttcttcagctaatgtgaaaacaaattcttattcttcagaacctaacaaacca
ttaacttctgaccagtttcatctgaccccttctctttgtaactcagaaaccaaggatgtc
ccatctttagctccgcctccaccaccaccgccgccgccgccgctgcggccatctccggtt
acttatcgcagttcattttccctctcttcacccttttcaactggatccacctcctcttct
gcattgctaagatcatcatctcctgcaatgtcagattcttcttcgttatctcaaatacca
tggaatgatctgccatcacctccaaacattgctaaaccttcactaccatcatctactatt
cctccacccccttgtccaccgccaagtttgaaagaaaacgcttgttctttcaaagcccca
cctcctcctcctccttccaaactccctcaattcatggcatttggaaaagagggaaatctg
ctgccgaaacttaagcctctccactgggacaaagtaagagctgcaccagatcgatcgatg
gtgtgggacaagctaagatggagttcatttgagctagatgaagaaatgattgagtcacta
ttcggctacaaccaacatggttcaatgaagaatggtgatgctagcaacaaaaccccttct
ccaagcaagcatatcctagaggctaagagacttcagaacctaaccatactcttaaaagcc
ctgaatctctcagcagaacaagcttgtgaagccatagaacaagggactgggttgcgttta
agacaacttgaagcactggtaaagatggtaccaacacaggaagaacaggccaaattgtta
agctatgaaggagacatcggtgaatacgggtgcacagagaagtttgtgatagcaatactg
agaataccattcgccttccaacgagtggaagccatgctctacagagaaacttttgaagat
gaagtgaatcatctccggaattcgttttcaatgctagaggaggcttgcaaggagctaaga
tccagcaggcttttcctgaaactacttgaagccgtgctcaaaacagggaaccgaatgaac
gtgggaacaagcagaggaggcgcaaaagcattcaaactagacgcactcctaagactctcc
gacgtcaaaggaaccgacggaaaaacctccctcctccatttcgtggtccaagaaataatc
cgatcagaaggaatccgagtctccggtagcataatggggaaaatcagccaaaagaacaaa
tcgagaacaatcgaagaaagagaaaacgattaccgaagaatgggattagatctggtctcc
ggcctgagcaccgaattacacaacgttaagcgagcagcgacaaccgatctgaaagttctg
gcgagcgccacagcgaatctgaacgagggaatggcgagattgcaagaactagtgttgaag
gaactgtgtggagatgaaaggagtgggaacttcgtgagcgcaatgaaagggttcttgagc
tacgtgaagaagacgatggagttggtgaggaaggacgaggaaggggtgatggggagcgtg
agagagatcacagagtacttccatggaaacgtgagcaaagaagagacgaatccgctgagg
atttttgtgattgtgagagattttttgggaatgttggacaatgtgtgtaaaagcttcaag
atcgggagttga

DBGET integrated database retrieval system