KEGG   Cucurbita moschata (crookneck pumpkin): 111443191Help
Entry
111443191         CDS       T05248                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00620  Pyruvate metabolism
cmos00710  Carbon fixation in photosynthetic organisms
cmos01100  Metabolic pathways
cmos01200  Carbon metabolism
Module
cmos_M00168  CAM (Crassulacean acid metabolism), dark
cmos_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cmos_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cmos_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111443191
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111443191
Enzymes [BR:cmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111443191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 111443191
NCBI-ProteinID: XP_022936664
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MPNRNVEKMASIDAQLRLLAPARVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGVFADENSATTESDIEETLKKLVGKLNKSPQEVFDALKNQTIDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSSELRERADVLHNSSRRDAKHYIEFWKQVP
ANEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCAC
GDRPIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLEAITQHLDIGSYKEWSEKQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVTQPLRVVPLFEKLADLEAAPAALARLFSIDWYKDRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRTLMDEMAVVATE
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKDVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWPFGQRLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNACQA
YTLKRIRDPNYHVTVRPHISREIMEASKSADELVKLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccggaatgtcgagaagatggcatcgattgatgcgcagcttcggcttttagca
ccagctagagtgagtgatgatgataaattggtggagtatgatgcgttgttgctggatcgg
ttccttgatattcttcaggatttgcacggggaggatctgaaggaaactgtgcaagaatgt
tatgaactttctgctgaatatgaagggaaacacgatccgaagaaactcgaggagctcgga
aatgtgctgactagtttagatccaggggactctattgtcattgccaaatctttttcccat
atgcttaatttggctaacttggccgaggaggttcagattgcttatcgtcgaaggatcaaa
ctgaagaagggagtttttgctgatgagaactctgcaaccacggaatctgacatcgaagaa
actctgaagaagcttgtggggaaactgaacaagtcccctcaagaagttttcgatgccttg
aagaaccagactatagatttggtcttaactgctcatccgactcaatcagttcgtagatct
ttgcttcagaagcatgcaaggatacgggactgtttagttcagttgtacgccaaagacatt
actcccgatgacaagcaagaacttgatgaggcacttcagagagagattcaagctgcattt
cgtactgatgaaatccgtagaactcctcctacaccacaagatgaaatgagggcaggaatg
agctacttccacgagacaatttggaagggtgttcctaaatttctgcgccgtgttgatact
gctttaaaaaacatagggatcgatgaacgtgttccttataatgcaccactaattcagttt
tcatcttggatgggtggtgaccgtgatggtaatcccagggtgacaccggaggttacaagg
gacgtctgtcttcttgctagaatgatggctgctaatctgtactactcacagattgaggat
ctcatgtttgagttgtctatgtggcgttgcagtagtgagcttcgtgagcgtgcagacgtg
cttcataattcatcaaggagagatgcaaaacactacatagaattttggaagcaagttcct
gccaatgaaccctaccgagtgattcttggcgacgtaagggacaagctttatcagacgcgt
gagcgttctcgccatttgttagctaatggatattcggacatcccagaggatgcgactttt
acaaatgttgagcagttcttggaacctcttgaactatgctacagatccctctgtgcttgt
ggtgatcgaccgattgctgatggcacccttcttgattttttgaggcaagtgtccactttt
ggcttgtcacttgtaagacttgacatcaggcaggagtcggatcgtcacactgacgttttg
gaagccattactcagcatttggatattggttcctacaaagaatggtccgagaaacagcga
caagaatggcttctatcggaacttagtggcaaacgtcctctttttggtcctgatcttcct
acaactgaagaaatatctgatgttttgaacacgttccatgtcatagcggaacttccttct
gataacttcggtgcatatatcatttccatggccactgctccgtctgatgttttagcagtt
gagctattgcagcgtgagtgccatgttacgcaaccgttgagagttgttcccctgttcgag
aagcttgcagatttggaggctgcaccagcagcccttgctcgcctcttctcgatagattgg
tacaaagaccggattaacggaaagcaagaagtcatgatcggctactcggattctggtaaa
gatgctggacggttctctgcggcctggcagttgtacaaggctcaagaggagcttataaag
gttgcaaagcaatatggtgtgaagctaactatgtttcacggtcggggtggcaccgttgga
agaggaggtggacctactcatcttgctattttgtcccaaccacccgagacaattcatggt
tcgctccgtgtaacagtacagggggaagttattgagcagtcctttggagaggagcacttg
tgttttcgaacactccaacgtttcactgctgcaacgcttgagcacggaatgcaccctcca
gtttcaccaaaacctgaatggcgtacactgatggacgaaatggctgttgttgcaacagaa
gaataccgttccatcgtcttccaagaaccacgatttgtcgaatatttccgccttgcaaca
cctgagctcgagtatggtaggatgaatattggaagccgtccatcaaaacgaaagccaagc
gggggtatcgagtcacttcgtgcaatcccatggatctttgcatggacacagacgcgattt
catcttccagtttggttaggctttggagcagcattcaagcatattattcagaaagatgtt
aagaaccttcaaatgttgcaggagatgtacaacgaatggcccttctttagggtcaccatt
gatttggtcgaaatggtgttcgctaaaggagaccctggcatcgcagcgttgtacgacaag
ctcctagtttcggaggacctctggccattcggacagcgcttgagagccaactatgaagaa
acaaagagccttctactgcagattgctggacacaaagatcttcttgaaggggatccttac
ttgaagcaaagactccgtctccgtgattcatacatcacgactctgaacgcttgccaagca
tacacgctgaaacgaatccgtgatccgaactaccatgtgacagtgcgtccacacatttca
agggaaataatggaagcaagcaaatcagcagacgaactggtgaagctgaacccgaagagc
gagtacgcacctgggctagaggacactctgatcttgaccatgaagggtattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system