KEGG   Cucurbita moschata (crookneck pumpkin): 111444770Help
Entry
111444770         CDS       T05248                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00250  Alanine, aspartate and glutamate metabolism
cmos00410  beta-Alanine metabolism
cmos00430  Taurine and hypotaurine metabolism
cmos00650  Butanoate metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Module
cmos_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111444770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111444770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111444770
   00430 Taurine and hypotaurine metabolism
    111444770
Enzymes [BR:cmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111444770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 111444770
NCBI-ProteinID: XP_022938574
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MVLSKTVSQTDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAFQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAAGKPYDNPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPQKAVELVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFIYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWAIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQMIRLGYEGYQNVMENCRENMLVLKEGLEK
TGRFNIVSKDNGVPLVAFSLKDSSRHTEFEVSEMLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVADIEKTMHELDILPSKADIKNTVAKKSELETQREITTVWRKFVMNK
KKTNGVC
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtccaagactgtttcacagacggatgtctccgtccactctaccttcgcttca
cgatatgtacgaacctctctcccgagattcaaaatgccggagaattcgatccctaaggag
gctgcgtttcagatcattaatgatgagctcatgctcgatggaaaccctaggctgaatttg
gcatccttcgtcaccacttggatggagcctgagtgcgataaactcatcatggccgctatt
aacaagaattacgttgatatggatgaatatcccgtcactacagagcttcagaaccgatgt
gtgaacatgatagctcacttgttcaatgccccattgggggaatccgagacggcggtggga
gtcggaaccgtgggatcgtcggaggccataatgttggctggtttggctttcaagagaaag
tggcagaacaaaatgaaggctgcaggcaagccctatgacaaccccaacatcgtcactgga
gccaatgtccaggtatgctgggagaaattcgcaaggtactttgaggtagaactgaaggaa
gtgaaattgagcgaaggttactacgtgatggatccacagaaagctgtggagttggttgat
gagaacaccatctgtgttgcagccattttgggttccactctcaatggagaattcgaagat
gtaaagctcttaaatgatctcttaatcgagaagaacaaggaaactggatgggatacccct
attcatgttgatgctgcgagtggagggtttattgccccattcatttaccctgatctagaa
tgggattttaggctgccccttgttaagagtattaatgtgagtggccataagtatgggctt
gtttatgctggaattggttgggctatctggaggaacaaggaagacttgcctgaagaactc
atcttccatatcaactatcttggagctgaccaacccactttcacccttaatttctccaaa
ggatctagccaagttattgctcagtattaccaaatgatccggttgggttatgagggatac
caaaacgtgatggaaaattgcagagagaacatgttggttctaaaggaaggactcgaaaaa
acgggtcgtttcaacatcgtgtcgaaggacaatggagtcccacttgtggccttctccttg
aaagatagcagtcgtcatacagagtttgaggtctcagaaatgcttaggagattcggttgg
attgtgcctgcctacaccatgcctccagatgcacaacacataacagtcctaagagttgtg
atccgagaagacttttctcgcacacttgcggagcgtctagtggcagatattgagaaaacg
atgcacgagctcgacatcctcccgtcgaaggccgatatcaagaacacggtggcgaagaag
agcgaactcgagacacagagggagatcacaactgtttggaggaagtttgtgatgaacaag
aagaagactaatggagtttgttaa

DBGET integrated database retrieval system