KEGG   Cucurbita moschata (crookneck pumpkin): 111445631Help
Entry
111445631         CDS       T05248                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00564  Glycerophospholipid metabolism
cmos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111445631
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111445631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_3 NAD_binding_8 Pyr_redox_3 GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 111445631
NCBI-ProteinID: XP_022939909
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MATATRLGKIAVAAVATAAGGSFLLQPSLASNDRGTSGHALESYRNKINDLTAVVPPRSV
QESALIGASPVNPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYKQLKLVFHALEERKQFIENAPHLCHALPCMTPCFDWFEVIYYWIG
LKMYDLVAGSRLLHLSRYYSAQESVELFPTLARNGQGRSLKGTVVYYDGQMNDSRVNVGL
ACTAALAGAAVLNYAEVVGFLKDEGNDRIIGATIRDKLSGREFDTYAKVIVNAAGPFCDS
VRKMADKEAVSMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTGITMVPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPSAKNTESISR
DHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLKPTNECVTNKLRLVGGDGWGP
AYFTVLAQQYLRMKKSHSGKVVPGVMDTAAARHLSLAYGILGEKVAAIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTDAANHALPRVIEILADEHNWDKKR
QKQELQKAKQFLETFKSSKNAHFHDGKHS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccacagccacacggctgggtaagatcgccgttgccgccgtagccaccgctgccggc
ggatcatttctgcttcagccttctctcgcctctaatgaccgtggtaccagtggtcacgct
ctcgagtcatacaggaacaagatcaatgatctgacagcagttgttccgccccgatcggtt
caggagtcggctctgatcggtgccagccctgtcaatcctcttgacattcttgttgttggc
ggaggcgccactggatgtggcgtcgcgctcgatgccgttactcgaggacttcgtgtaggc
ctcgttgagcgcgaggatttctcatccgggacgtcttcgcgctctaccaagctcattcat
ggaggcgtgcggtatttggagaaagcagtgttcaatttggattacaagcagcttaaattg
gtgtttcatgcgcttgaggagcgaaaacagtttattgaaaatgcaccacacctatgccat
gcgttgccctgcatgacaccttgttttgactggttcgaggttatctactattggattggg
ttgaagatgtacgatttggttgcagggtctcgcctcttgcacttgtctcggtactattct
gcccaggagtccgtggagctcttccctacccttgctaggaatggtcagggcagaagtttg
aaaggcaccgttgtgtattacgacgggcagatgaatgactcgcgggtcaatgtggggctt
gcttgtactgccgctctggctggtgcggcggtgctgaattatgcagaagttgtgggattt
ttgaaggatgagggtaatgatcgaatcatcggagcgacaattcgtgacaagttgtcaggt
agagagtttgatacctatgcaaaggtgattgtcaatgctgctgggccattttgtgactca
gtgagaaagatggccgataaagaggcagtgtctatgatctgtcccagcagtggtgttcat
gtagttctccctgattattattctcccgaaggaatgggtctgattgttcccaagactaag
gatgggcgtgttgtttttatgctgccatggttaggacgaacagttgctggaaccacagat
tccaacactggcatcactatggttcctgagccacacgaggatgaaattcagttcatactg
gatgcaatatctgattaccttaacgtgaaggtgcggcgaacagatgttctctcagcttgg
agtggtattcgtcctttggctatagatccatcagctaaaaatacggagagcatctcaaga
gatcatgttgtttgtgaagattatcccggattggtcacaattactggcgggaaatggact
acttatcggagcatggcagaagatgctgttaatgcagctataaagtccggaaagctgaag
ccgacaaatgaatgtgtaactaacaagctgcgacttgttggtggagatggatggggacct
gcatattttactgtcttagctcaacaatatttacgcatgaagaagagtcatagtggtaaa
gttgtccccggagttatggacactgcagctgcaagacatttatctcttgcgtatggcatt
ttaggtgaaaaagtggccgctatagcccagaatgagaatttgggtaagcggttagcccat
ggctaccccttcttggaggctgaggttgcatactgtgcgaggcatgagtattgtgaatct
gcagtagatttcattgccagaagatcacggctcgctttccttgatacggatgctgctaat
cacgcattgcctcgagtaatcgagatattagcagatgaacataattgggataagaaaaga
cagaagcaagaactacagaaggccaagcagtttttagaaactttcaagtcttcaaagaat
gcccacttccacgatggaaagcacagttag

DBGET integrated database retrieval system