KEGG   Cucurbita moschata (crookneck pumpkin): 111446712Help
Entry
111446712         CDS       T05248                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00904  Diterpenoid biosynthesis
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    111446712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cmos00199]
    111446712
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     111446712
Cytochrome P450 [BR:cmos00199]
 Cytochrome P450, plant type
  CYP701 family
   111446712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 111446712
NCBI-ProteinID: XP_022941414
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MAVATDPLGCMQKLVQMLQAPPYVAAAVLGGVLLLTIFIGDWRKRRRSPLPPVPAIPGIP
VLGNLLQLKEKKPHKTFAQWSETYGPIYSIKAGASTVIVLNSSDLAKEAMVTRYSSISSR
KLSKALTILTADKCMVAMSDYNDFHKLVKRYILANVLGANAQKRLRQRRDTMIDNISREL
LARVKDSSSESVNFRKIFESELFGLALKETFGRDMESLYVDGLGTTLRREDLFRTLVIDP
MEGAIEVDWRDFFPYLRWIPNKGVEDRITKMDFRRGVTMKSLVEEKKKRIAAGEDLNCYS
EFLLSEAKSLTEEQISMLLWEIIIETSDTTLVVTEWAMYELAQNPKRQERLYQHIQSVCG
SAKITEENLSQLPYLTAVFHETLRKYSPVSIVPLRYAHEDTQLGGYFIPAGSEVAVNIYA
CNMDKKQWESPEEWKPERFLDESYDPMDLYKTMAFGGGKRVCAGAPKAMLIACTTLGRLV
QEFTWKLREGEEDKVDTFGLTARKLQPLHIVAKPRIN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcgactgatccgctcggctgcatgcaaaaactcgtccagatgcttcaggct
ccgccgtatgtcgcggccgccgttctgggtggtgtgttgcttctgacgattttcatcgga
gattggagaaagagacgtcggagtcctctacctccggtgccggcgattccggggataccg
gtgctggggaatctgttgcagttgaaggagaagaagccgcacaaaacgtttgctcaatgg
tccgagacgtatggtccgatttattccataaaagccggcgcctccactgtgatcgttctc
aactcctccgatctcgccaaagaggctatggtgacgaggtactcttccatttccagtaga
aaactaagcaaagccctcactatcttgactgctgataaatgcatggttgctatgagcgat
tacaatgactttcataagctggttaagagatacatattggctaatgtcttgggggctaac
gctcagaaaagactcagacaaaggagagacaccatgatagacaatatttccagagaattg
ttggctcgtgtgaaggattcttcatcagaatctgttaatttccgaaagatctttgaatcg
gaactcttcgggctggcgcttaaagaaacgtttgggagggatatggagtcgttatatgtc
gatgggcttggtacgacgttgcggagagaagatctgttcagaactttagtgattgatcca
atggagggtgcgattgaggttgattggagagatttcttcccatatctgagatggattccc
aacaagggtgtggaggataggatcacgaagatggactttcgcaggggagtgacgatgaag
agcctcgtggaggagaagaagaagcgaattgcagctggggaggatttgaattgctattct
gagttcttgttatctgaagcaaaatcactcacagaggaacagatatccatgttgctctgg
gagataatcattgaaacctcagacactactctggttgtaactgaatgggctatgtatgaa
cttgctcaaaatcctaaacgacaggagcgtctatatcagcatatacaaagtgtgtgtgga
tctgcaaagattactgaagaaaacctgtcacagctcccatatttgactgccgtttttcac
gaaactcttcggaagtacagtccagtctcgatcgttccattgcgatatgcgcatgaagat
acccagttaggcgggtacttcattcctgcagggagtgaggttgctgtgaacatttacgcc
tgcaacatggacaagaaacaatgggaaagccctgaggaatggaagccagagaggtttctt
gatgagagctatgatccaatggacctgtacaaaaccatggcgttcggaggcgggaagagg
gtgtgtgcaggtgcccccaaggcaatgctgattgcttgcactacccttggaagactggtt
caagagttcacttggaagctgagggaaggagaagaagacaaggtcgacactttcggcctc
actgctcgcaagctccaaccactgcacatcgtcgccaaaccgagaatcaactaa

DBGET integrated database retrieval system