KEGG   Cucurbita moschata (crookneck pumpkin): 111447282Help
Entry
111447282         CDS       T05248                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111447282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmos02000]
    111447282
Enzymes [BR:cmos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111447282
Transporters [BR:cmos02000]
 Other Transporters
  Pores ion channels [TC:1]
   111447282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3 Tom37 GST_C_6
Motif
Other DBs
NCBI-GeneID: 111447282
NCBI-ProteinID: XP_022942111
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MANEVKLLDFWPSMFGMRVRIALAEKGVAYEYVEEDLRNKSPLLLQMNPIHKKIPVLVHN
GKPISESSIIVQYIDETWKDRAPLLPSDPYERAQARFWVDFIDKKLYDETRKTWGSKGEE
QEAGKRGMIAILKQLEEVLGEKAFFGGECLGFLDIGLIGFSSWFYSYETIGKFSIEAECP
KIMAWVKRCLQKESVSKSLPDPMKVYPFVLEIMKALGLD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgaagtgaagctgttggatttctggcccagcatgtttgggatgcgagttaga
atagctctggccgagaagggcgtggcgtacgaatacgtggaagaagatctgagaaacaag
agccctttgcttctgcagatgaacccaattcacaagaaaatccctgttcttgttcataat
ggaaaacccatctccgaatcttccattatcgttcagtacatcgatgaaacgtggaaggac
agagctcctctgttgccgtctgatccatacgagagggctcaagccaggttttgggtggat
ttcatcgacaagaagctttatgatgaaacgaggaagacatgggggagcaagggagaggag
caggaggcagggaagagggggatgattgcaattttgaagcaactggaggaagttcttggg
gagaaggctttctttggaggagagtgtttggggttcctagacattggtttgattggattc
tcatcttggttttatagctatgagaccattgggaagttcagcatcgaggcagagtgtccc
aagatcatggcttgggtgaagagatgcttgcagaaggagagtgtttcaaagtccctgcct
gaccccatgaaagtgtatccctttgtgcttgaaattatgaaagcgcttggccttgactaa

DBGET integrated database retrieval system