KEGG   Cucurbita moschata (crookneck pumpkin): 111448471Help
Entry
111448471         CDS       T05248                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03030  DNA replication
cmos03410  Base excision repair
cmos03420  Nucleotide excision repair
cmos03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111448471
   03410 Base excision repair
    111448471
   03420 Nucleotide excision repair
    111448471
   03430 Mismatch repair
    111448471
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmos03032]
    111448471
   03400 DNA repair and recombination proteins [BR:cmos03400]
    111448471
Enzymes [BR:cmos01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111448471
    6.5.1.6  DNA ligase (ATP or NAD+)
     111448471
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111448471
DNA replication proteins [BR:cmos03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111448471
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111448471
DNA repair and recombination proteins [BR:cmos03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111448471
   NER (nucleotide excision repair)
    Other NER factors
     111448471
   MMR (mismatch exicision repair)
    Other MMR factors
     111448471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 111448471
NCBI-ProteinID: XP_022943872
LinkDB All DBs
Position
Unknown
AA seq 804 aa AA seqDB search
MLSLRSCYCLRPITLPHPQFKKLIFSNKPPPFKPIFQNFVSAMSSRPSAFDALMSGARAA
AKKKPVNSSPKKRKALDSLGPPPKPNSSLALESTPPVESQCGSSTSTLDNHGDPNPVKSE
EAVDLGETKLRQDDGGNFGGKIGPVANKKCASSVQERTAKLKSSIPELKKKAKDFNSKTF
ACWNEGERVPFLFLCLGFDMISEESSRITITDIVCNMLRTVMDTTPDDLVATVYLLANKI
APAHEGLELGIGDASIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKPDA
LTITKVFDSFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAEQT
LLAALGQAAVYAEKHSTPPANVQSPLEEGAKIVKQVYSVLPVYDKLVPALLNGGVWNLSK
TCNFTPGIPIGPMLAKPTKGVSEILNKFQGLEFTCEYKYDGERAQIHYMEDGSVEIYSRN
AERNTGKFPDVVLTVSRIKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAVSD
IKVEVCVFAFDLLYLDGQPLIHKELSVRREHLYDSFIEEAGYFQFATAITTSDLEEIQKF
LDASVDQSCEGLIIKTLNRDATYEPSKRSLNWLKLKKDYIDNIGDSLDLVPIAAFHGRGK
RTGVYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSASLRSKVIPEPKSYYRYGDTI
NPDVWFEPTEVWEVKAADLTISPVHRAGVGIVDSNKGISLRFPRLVRVRKDKTPEEATLS
EQVADMYNAQKLNHQNNQDDNDED
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgcgttcatgctactgtttacgccccattacattgcctcatccccaattc
aagaaactcatcttctccaacaaacctccccctttcaaacccatttttcagaattttgtt
tcagcaatgtcttctcgtccttctgctttcgatgctctcatgtccggtgctcgggccgct
gccaagaagaagcctgtaaattcttctcccaagaagcgtaaagccctagattctttaggc
cctcctccgaaacctaactcttccctggctttggagtcaacgccgcctgttgaatcgcag
tgcggtagttcaacctcaactttggataatcatggagatcctaatccggttaagtccgag
gaagctgtagatttgggggaaaccaagttgcgtcaggatgatggtgggaattttggaggc
aagattgggccggttgcgaataagaagtgcgcgtctagtgttcaagaaagaactgcgaaa
ttgaagagctctatcccagagttgaaaaagaaggccaaggatttcaactcgaaaacattt
gcatgttggaatgagggcgaacgggttccatttttgtttctgtgtttggggtttgatatg
atttcggaggagtctagtaggattactatcaccgatatcgtctgcaacatgttgaggacc
gtcatggatactacacccgacgacttggtagccactgtgtatcttttggcgaataagatt
gctcccgcgcacgaagggctcgagttgggtattggggatgcttctattatcaaagctctt
tctgaggcatttgggaggacagaggcacaggttaaaaaacagtacaaggaattgggagat
ttaggtcttgttgccaaagcgagccgttcgtcacaatccatgatgcgaaagcctgatgct
ttaactattaccaaagtatttgactcatttcggctgatcgctaaggaatctggcaaggat
agtcaggagaagaaaaagaaccatatcaagtcactgcttgttgctgccactgactgcgaa
cctttgtatctgattagattgctgcagacaaaattgcgaattggacttgctgagcagact
cttttagctgcattagggcaagcagctgtatatgctgaaaaacattcaacacccccagcg
aacgttcaatctcctctagaagagggtgctaagattgtaaagcaggtgtattctgtgctc
cctgtttatgataaacttgtccctgcgcttcttaatggtggtgtgtggaacctttcaaaa
acatgcaactttacaccgggaattccaattggacctatgttggcaaaaccaacaaaggga
gtctccgagatcttaaataaattccagggtttggaatttacttgtgaatacaaatatgat
ggggaacgtgcccagattcattacatggaagatggttcagttgagatctacagtcgaaat
gctgaacggaacactggaaagttccctgatgttgttctcacggtatcaaggataaagaaa
ccatctgtaagatcgtttattttggattgtgaacttgttgcttatgatcgtggaaaacag
aagattttgccttttcagattctgagtacacgagctcgcaagaacgtggccgtgagcgat
attaaggttgaagtgtgtgtatttgcttttgatttactgtatctcgatggtcaaccactt
attcataaagaacttagcgttcgtcgagagcatctctatgattcatttattgaagaagct
ggatattttcaatttgccacagcaataacaacaagcgatcttgaggaaatacaaaaattc
cttgatgcatctgttgatcaaagttgtgagggtttaatcatcaaaacattgaaccgggat
gctacttacgagccttccaagaggtcacttaactggctaaaactgaagaaggattacata
gacaacataggggattcacttgatctggtaccaattgctgctttccatggccgtgggaag
cgtacaggtgtctatggcgcatttctccttgcctgttatgacaatgacaatgaagaattt
caaagcatttgtaagattggaactggtttttctgaagcaatgcttgaggaacgttctgct
agtctccgttctaaagtcattccagaaccaaagtcatattatcggtatggagatacaatc
aatccagatgtttggtttgaacctactgaggtttgggaggttaaagcggcagacttgact
atcagcccagttcatcgtgcaggagtcggcatcgtggattccaacaagggaatttctctt
cggtttccacgtcttgttcgtgtaaggaaagacaaaactccagaggaggccacattgtct
gagcaggttgccgacatgtataatgctcagaaactcaaccaccaaaacaatcaagatgac
aatgatgaagactga

DBGET integrated database retrieval system