KEGG   Cucurbita moschata (crookneck pumpkin): 111451177Help
Entry
111451177         CDS       T05248                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmos00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    111451177
Enzymes [BR:cmos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111451177
Chromosome and associated proteins [BR:cmos03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111451177
   Polycomb group proteins
    PRC2-EZH2 complex
     111451177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 111451177
NCBI-ProteinID: XP_022947255
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MLKVDNIIPLWRVVFWLLGLALPLTMKPEGQDPSPKEILSVIDFLKKQVAGERCNSIQKR
MEENKQKLVDITTHLLKSSAERRIRRIHDSDKGVDLLTKRQKDALDMQNGIDVSDGENDQ
SQEDGHASSAVLLGSNVAVRNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRR
IYYGQSGGEALICSDSEEEAIEDEEEKRDFVESEDYILRMTIKEIGSSDLVLESLATCFS
RSPGEIMARYEVLTQGETAVGCFNNRINEEISRMGSSVLDKDLDAALDSFDNLFCRRCLV
FDCRLHGCSQDLVFPAEKQPKWVVGEENAPCGPLCYRSVLKSNKNDTGGSPLCSDLEEKQ
PMSSDVTGTQISTKKKSSKAARRRAKSYQSESASSNAKNLSESSESDNEPRQDGNTIHLS
PSPHSKITGAGGIRKRNSKRVAERVLICMQKRQKKMAASESESLASVGHCSNDVKLKSNS
CKENDDTSSSSRKNIRAPTPGRSRRRESLTQKCNKFEQNETLLNSSNEILTHIPADSCDD
NSRKEECVDENLCKQDLADDKSWKAIEKGLYEKGIEIFGRNSCLIARNLLNGMKTCWEIF
QYMNYSENKNCSQVGDGSNPHLEGYAKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSI
RKRITERKDQPCRQYNPCNCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQ
CRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLG
RSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDA
YRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWA
RKPEASGSKKDDGAPSSGRAKKLA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtggacaatatcataccattgtggagagtcgtgttctggctcttgggtctt
gcccttcctctaacaatgaaaccagaaggacaagatccttctcctaaggagatcctatca
gtcattgattttctaaagaagcaagttgccggtgaacgttgtaactccatacagaaaaga
atggaagaaaacaagcagaagttagtcgacatcaccactcacttgttgaaatcatcagca
gaaagaaggataagaaggatacacgattcagataagggagtggatctattgacaaagagg
cagaaagatgcccttgatatgcagaatggtatagatgtaagtgatggggaaaatgatcaa
tctcaagaagatgggcatgcatcttctgctgttcttcttggatctaatgttgcagttaga
aatgctgtacgacctattaagcttcctgaagttaaaagattacctccttatactacatgg
atatttttggacagaaatcagagaatgacagaagatcaatctgtggttggtcggaggaga
atatattatggtcaaagtggaggagaagcccttatttgcagtgatagtgaggaagaagca
atcgaggacgaggaggaaaagagagacttcgtggaatctgaagactatatacttcgaatg
acgataaaagaaatcggttcatctgatctggtgctagagtcacttgccacttgtttttct
agaagtcctggtgaaataatggcaagatatgaagtgcttacccagggagaaacagctgta
gggtgttttaataataggatcaatgaggagatctcacgtatgggaagttctgttcttgat
aaagatcttgatgcagctcttgattcgtttgacaatctattttgccgccgctgccttgtc
tttgattgtagactacacggttgttcccaggatcttgtctttcctgctgagaaacaacct
aaatgggtagtaggtgaggaaaatgcaccctgcggtccactctgctatcgatcggtactg
aaatcaaacaaaaatgatacagggggttctccactttgcagtgacttggaagaaaaacag
cccatgtcatctgatgttactggcacccaaatctcaacaaaaaagaaatcttctaaagct
gctcgaagaagggcaaaatcctatcaaagtgaaagtgcctcatcaaatgcaaagaactta
tctgaaagcagcgagtcagataacgaacccaggcaggatgggaatactattcatctatca
ccatcaccacattctaagataactggagcaggtggaatacgaaaaaggaacagcaagcgt
gttgctgagcgtgttctcatttgcatgcagaagaggcagaagaaaatggctgcgtccgaa
tcagaatctctagccagtgtaggtcattgttcaaatgatgtgaaattaaaatctaattct
tgtaaagaaaatgacgatactagttcttcatcacgtaagaacattagagctcctacaccg
ggaaggtccaggaggagggaatccctgactcaaaaatgcaacaaatttgagcagaatgaa
acacttcttaattcatcaaatgagatacttactcatataccagctgacagttgtgatgac
aactcgaggaaggaagaatgtgtggatgaaaatttatgcaagcaggacttggcagatgat
aaatcctggaaagctattgaaaaaggtctttatgagaagggtattgagatttttggtagg
aacagctgcttgatagcaaggaatttactaaatgggatgaaaacctgttgggaaattttt
caatacatgaattattctgagaataagaattgcagtcaagtaggtgacgggtcaaatcct
catcttgaaggatatgccaagggtaataacgaggtgagaagaaggtcgaggttcttgcgt
agaaggggtagagttcgtcgacttaaatatacttggaaatcagctgcttaccattcaata
cggaagcgaataactgaaaggaaagatcagccgtgcagacagtataatccatgtaattgc
caaactgcatgtggaaagcagtgtgcctgtctcttaaatggcacctgttgtgagaagtac
tgtgggtgccctaagagttgcaagaaccgttttagaggatgtcattgtgctaaaagtcaa
tgtcgtagtcgtcaatgtccttgctttgcagccgatcgagaatgtgatccagacgtttgt
aggaactgttgggtcagctgtggtgatggttctcttggagttcccaaccaaagaggtgac
aattatgagtgcaggaacatgaagcttcttcttaaacaacaacaaagggtgttacttgga
agatctgacgtatctggttggggagcatttctaaagaatagtgttggcaaacacgaatat
ctcggcgagtacaccggcgagttaatttctcacagggaggctgataaacgaggaaaaata
tacgaccgtgaaaactcgtcgtttctgttcaatttgaacgaccagttcgttctcgatgca
taccgaaagggcgataaattaaaatttgccaatcattctccagatccaaactgttatgcc
aaggtcatcatggttgcaggagatcaccgggttggcatctttgccaaggaaagaatcagt
gctggtgaagaactgttctatgattatagatatgagcccgatcgagcgcctgcgtgggca
aggaagccagaggcgtcagggtcgaaaaaggacgatggtgctccttcgagtggtcgagcg
aagaaactcgcataa

DBGET integrated database retrieval system