KEGG   Cucurbita moschata (crookneck pumpkin): 111452317Help
Entry
111452317         CDS       T05248                                 

Definition
(RefSeq) DNA ligase 6-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03030  DNA replication
cmos03410  Base excision repair
cmos03420  Nucleotide excision repair
cmos03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111452317
   03410 Base excision repair
    111452317
   03420 Nucleotide excision repair
    111452317
   03430 Mismatch repair
    111452317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmos03032]
    111452317
   03400 DNA repair and recombination proteins [BR:cmos03400]
    111452317
Enzymes [BR:cmos01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111452317
    6.5.1.6  DNA ligase (ATP or NAD+)
     111452317
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111452317
DNA replication proteins [BR:cmos03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111452317
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111452317
DNA repair and recombination proteins [BR:cmos03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111452317
   NER (nucleotide excision repair)
    Other NER factors
     111452317
   MMR (mismatch excision repair)
    Other MMR factors
     111452317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 111452317
NCBI-ProteinID: XP_022948738
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MASESSTAKPLAIDSSLSFVTAIESFSRQLNLSLPPLKLPFRPPPLPADFPQSKLIPKSR
FVVDAFSHAGEFSVSYFLSHFHSDHYAGLSPTWCKGIIFCSDVTARLLLEVLKVPLPFVQ
SLPLREPVVIDGCEVILIDANHCPGAVQFLFKIPSADEKFERYIHTGDFRFCDSMIIDPV
LKTFIGSDAVFLDTTYCNPKFIFPSQDESIEYIVNMIQKIGGESKGSMGSVLFLIATYVI
GKEKILLQIASRCNRKIMVDARKMTVLRILGYGGENGVFTEHESESDVHVVGWNVLGESW
PYFRPNFERMNDIMVEKGYSKVVGFVPTGWTYEMKHKNFSVRSKDSLEIHLVPYSEHSNY
NEIREFVKFLKPRRIVPTVGLDVDKLDSKHADKIRKHFAGLVDEMANRKEFLKGFHRGEM
SDDIDETATMTVNEDLEEMETVSETCGSSMALSSLQEVGSTDRSVLNDEEQKKIIQELRE
CLPAWVTQDQILELISRSGRNVVDAVSNFYEQETEFYEHIASLPDNLPKFQGKVVDRPFI
FPARDDIKKNVFLGNFDISSGQASKSSSPRGKTTTKSKASPGKRKRNLQGKSKKNSSLQS
DGSKQSTITKFFGKA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaatcttccaccgctaaacccttagcaatcgactcatccctctccttcgtc
actgccattgaatccttttcacggcaattgaatctctctcttcctcctctgaagctccca
ttccggccgcctccattaccggccgatttcccccaatccaaactcattcccaaatcccgt
ttcgtcgtcgacgcattttctcacgctggtgagttctctgtttcctatttcctttcccat
tttcactccgatcactatgccggtctctcccctacttggtgcaagggtatcatcttctgc
tctgatgttaccgcccgccttttgcttgaagttctcaaagtcccgttgccgtttgttcaa
tcattgccgcttcgggagcctgtagtaatcgatggatgtgaggtaatacttattgatgcc
aaccattgtcctggtgcggtgcagttcttgtttaagattcctagtgcggatgaaaagttt
gagagatatattcatactggggattttcggttttgtgattctatgataatcgaccctgtt
ttgaaaacgtttattggttcggatgcagttttcttggacactacttattgtaatccgaag
tttatttttccttctcaggatgagtctattgaatatattgtcaacatgatacaaaaaatt
ggaggtgaaagtaagggttctatggggagtgttcttttccttatagcaacttatgtaatt
ggtaaggaaaaaattttgcttcaaattgcaagtagatgtaatcgtaagataatggtggat
gctaggaaaatgacagttttaaggattttggggtatggtggtgagaatggggtgtttact
gagcatgaaagtgaaagtgatgttcatgttgttggatggaatgttttgggtgagagctgg
ccttattttaggcctaattttgaaagaatgaatgatataatggtggaaaaggggtattct
aaggttgttggttttgttccaacagggtggacttatgagatgaaacacaagaacttctca
gtgaggtctaaggattcgcttgagatacatttggtgccatatagcgaacattcaaactac
aatgaaattagggaatttgttaagtttttgaagcctagaagaattgttcccactgtaggt
ttggatgttgataaacttgatagcaagcatgctgataagattaggaagcattttgctggt
ttagttgatgaaatggccaacagaaaagaattcttaaaagggtttcatcgtggagaaatg
agtgatgatattgatgaaactgccacaatgactgtaaatgaggacttggaagagatggaa
actgtatcagaaacatgtggtagtagtatggcgttgtcttctctgcaagaagttggttct
accgatcgatccgtgttgaatgacgaggagcagaagaagattatccaggaacttcgtgag
tgcttgcctgcatgggtgactcaggatcagatattagagctgattagcaggtctgggaga
aatgtggttgatgcagtttctaatttctatgaacaagaaactgaattttatgaacatatt
gctagtctcccggacaaccttcccaagttccaaggcaaagttgtagataggccatttatt
tttcctgcaagagatgatattaaaaagaatgttttcttgggaaattttgacatttcttca
ggccaagcttcgaagtcgtccagtccaaggggcaagacgacgaccaagagcaaagcttct
cctggaaaaaggaagagaaatcttcagggtaagtcgaaaaagaattcaagtctgcaatct
gatgggtcaaagcaatctacaatcacaaagttcttcgggaaagcttga

DBGET integrated database retrieval system