KEGG   Cucurbita moschata (crookneck pumpkin): 111453967Help
Entry
111453967         CDS       T05248                                 

Definition
(RefSeq) lysophospholipid acyltransferase LPEAT1-like isoform X1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00564  Glycerophospholipid metabolism
cmos00565  Ether lipid metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111453967
   00565 Ether lipid metabolism
    111453967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmos01004]
    111453967
Enzymes [BR:cmos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     111453967
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     111453967
Lipid biosynthesis proteins [BR:cmos01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   111453967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase Choline_transpo
Motif
Other DBs
NCBI-GeneID: 111453967
NCBI-ProteinID: XP_022950982
LinkDB All DBs
Position
Unknown
AA seq 390 aa AA seqDB search
MASELQQLRFDPPQSNASDESSARDDRPLLNPDSGAVADQDSDDIHLKYAPFSRRDAYGT
MGRGELPWMEKVLLGMALITIVPIRVVFGMSLLFLYYMICRICTLLYDPNRETDEQEDYA
HMVGWRRSVIVWSGRFVSRAMLFVLGFYWISEVNRIPPNENKSTNENEGQENSQESERPG
VIISNHVSYLDILYHMSSSFPSFVAKRSVAKLPLVGIISKCLGCVYVQRESKTTESKGVS
GVVSERIREAVKNSSAPMMMLFPEGTTTNGEYLLPFKTGAFLSKAPVLPLILRYPYQRFS
LAWESMAGGRHFLLLLCQFVNHLEVIRLPVYVPSQEEKDDPKLYASNIRRFMAKEGNMLL
SDIGLPEKRVYLAALNGNNNIRSVLHQKDD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgagctccagcaattgaggttcgacccaccccaatccaacgcatccgatgaa
tcctctgccagggatgatcgcccattgttgaaccccgattctggcgccgtcgccgaccag
gattccgacgatatccacctcaaatatgctccgttttcccgtcgggatgcttacggcacc
atgggccgcggggagctgccgtggatggagaaggtgctgctcggaatggcgctcattacg
atcgttccaatacgagtggtttttggaatgagtttgctgtttctctattacatgatttgc
agaatttgtacgttgctttatgatccaaatagggagacggatgagcaggaggattacgcg
catatggtgggatggaggaggtccgtgattgtttggtctggaagattcgtgtccagagct
atgttattcgtgttagggttttattggatttcggaagttaatcgaatcccgccgaatgag
aacaagtcaactaacgagaacgaggggcaagagaattcccaagagtctgaaagaccgggg
gttatcatcagcaaccatgtatcatatttggatattttgtatcatatgtcttcttccttt
cccagctttgttgctaagagatcagtggctaaacttcctctagttggtattatcagcaag
tgccttggctgtgtttatgttcaacgggagtcaaagacaactgaatccaagggtgtttca
ggtgttgtgagtgaaagaattcgagaagctgtgaagaatagctctgctcccatgatgatg
ctttttccagaaggaacaactaccaatggggagtatctcctaccatttaaaacgggggca
tttttgtcgaaagctcctgttcttccattgattttaagatatccgtatcagagatttagt
ttggcctgggaatcaatggctggagggcgtcattttttacttcttctctgtcaatttgta
aatcacttggaggtaataagattgcctgtctacgtcccatcacaagaagaaaaggatgat
cctaagctttatgctagtaatatcagaaggtttatggccaaagagggaaatatgctgctt
tcggatattgggctcccagagaagcgtgtttatcttgctgctctgaatggtaataataac
atccgtagtgttttgcatcagaaagacgactga

DBGET integrated database retrieval system