KEGG   Cucurbita moschata (crookneck pumpkin): 111458468Help
Entry
111458468         CDS       T05248                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00010  Glycolysis / Gluconeogenesis
cmos00020  Citrate cycle (TCA cycle)
cmos00620  Pyruvate metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Module
cmos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111458468
   00020 Citrate cycle (TCA cycle)
    111458468
   00620 Pyruvate metabolism
    111458468
Enzymes [BR:cmos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111458468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 111458468
NCBI-ProteinID: XP_022956930
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MASSFLSRAALSGNTTAISFSFSSSISSPLPWSSSRSYTSFPANSRRRIPVIQSKIREIF
MPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVIGEGET
APVGAPIGLLAETEEEVAEAKAKAASKSASTPSTPAAAVSPSPPPPSSSPAPATSQPSPP
PPMAASDGPRKTVATPQAKKLAKQHKVDIGSITGTGPFGRITPADVEAAAGIAPSKPAVS
NVASPVASETASVAAAAPAKAAAAPSNLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTF
RVGYPVSTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNIN
IAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPNEYNSGTFTLSNLGM
FGVDRFDAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLAAF
LQTFAKIVENPESLTL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcgttcctctctcgagctgctctctccggcaataccaccgccatttcattt
tccttctcttcttccatctcttctcctctcccatggagctcttcccgttcatacacctcc
tttcccgctaattctcgtcggaggattcctgtcattcaatccaagatccgcgagattttc
atgcctgccctaagctctaccatgactgagggaaagattgtttcgtgggtcaaatctgaa
ggggacgttctatccaaaggagagagcgtcgtcgtcgtggagtctgacaaggcggatatg
gatgtggagactttttatgatggaattctcgctgctattgttattggagagggtgaaact
gcccctgttggagctccgattggtttattggccgagactgaagaggaagtcgctgaggct
aaggctaaagccgcgtcaaaatccgcgtctactccttcgactcctgctgctgctgtttct
ccctctcctccgcctccttcttctagtcctgctccggcgacatctcagccatcgcctccg
ccgcccatggctgcgtcggatggaccaaggaagactgtggctacccctcaggcgaagaag
ctagccaaacagcacaaggtggatattggatcgataaccggtactggtccatttggtcga
attacgccggcggatgtggaggccgcagcaggaattgccccttcgaagcctgctgtaagc
aatgtggcttcacccgtggcttctgagactgcttcagtggctgccgctgctccagcgaaa
gccgctgcagctccttccaacttgcctcctccagttccgggctcaacggttgtgccattc
acgacaatgcaggcggcggtgtctaagaatatggtggagagtctctctgttcctacattc
cgagttggttatccggtatccactgatgctcttgatgcgctctatgagaaggtgaaacca
aagggtgtcacaatgactgccctcctggccaaggctgctgcaatggccctcgctcagcat
cctgttgtaaatgcaagctgtaaagacggtaagagctttacgtataacagcaacataaat
attgcagtagccgtggctatcaacggtgggttgataactcctgttcttcaggatgcagat
aagttggacctctacctactatctcaaaaatggaaagaattggtagagaaagccagatcc
aagcagcttcagcccaatgagtataattcaggaacttttactctttccaatctgggcatg
tttggagtggacaggttcgatgctatacttcctcctggccagggagctatcatggccgtt
ggagcatcaaagccgaccgttgtcactgatgctgatggctttttcagcgtgaaaagtaaa
atgttggtgaatgtgaccgctgatcaccgaatagtttatggtgctgacttggctgccttc
cttcagaccttcgctaagatagttgagaatccagaaagcctgaccttgtag

DBGET integrated database retrieval system