KEGG   Cucurbita moschata (crookneck pumpkin): 111459815Help
Entry
111459815         CDS       T05248                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111459815
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111459815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111459815
NCBI-ProteinID: XP_022958658
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MQAVLAAMAAQSLISASPSSYIQVSPFSISSPPPSLISSFHGASLKLPRHSLSLAASVAP
KPFVVVAATKKAVAVLKGTSNVEGVVTLTQEDDGPTTVNVRITGLTEGLHGFHLHEYGDT
TNGCISTGPHFNPNKLTHGAPEDEIRHAGDLGNIVAKADGVAEATIVDNQIPLSGPNSVV
GRAFVVHELEDDLGKGGHELSSTTGNAGGRLACGVVGLTPV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagttctcgcagctatggcggcgcaatccctcatctctgcctccccttccagc
tacatccaagtgtctcccttctcaatttcttcccctccgccttccctaatctcctccttc
catggcgcctctctcaagctacctcgccactccctctccctagcagcctccgtcgccccc
aagccttttgttgtcgttgccgctaccaagaaagccgtcgccgttctcaagggtacttcc
aatgtcgaaggcgtcgtcacgctgacccaagaagacgatggtccaacaacagtaaatgtt
cgaattaccgggctcacggaagggcttcatggattccatcttcatgagtatggagacaca
acaaatggatgcatttctacaggaccacatttcaatcctaataagttaactcatggtgct
cctgaggatgaaatccgtcatgcgggtgacctgggaaacattgttgccaaggctgatgga
gtagcggaggcaaccattgtagataatcagattcctctcagtggccccaactctgtagtt
ggaagagcctttgtggtacatgagcttgaggatgatcttggaaaaggaggtcatgaactc
agttcaaccacaggcaacgctggtggaagattggcatgtggtgttgtcgggctgactccc
gtgtaa

DBGET integrated database retrieval system