KEGG   Cucurbita moschata (crookneck pumpkin): 111460069Help
Entry
111460069         CDS       T05248                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like isoform X1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00071  Fatty acid degradation
cmos00592  alpha-Linolenic acid metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01212  Fatty acid metabolism
Module
cmos_M00087  beta-Oxidation
cmos_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111460069
   00592 alpha-Linolenic acid metabolism
    111460069
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     111460069
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     111460069
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     111460069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 111460069
NCBI-ProteinID: XP_022958921
LinkDB All DBs
Position
Unknown
AA seq 746 aa AA seqDB search
MGSNAKGRTEMEVGDDGVAIITIINPPVNALSFDVLFSLRDSYEQAMKRDDVKAIVVTGA
MGKFSGGFDIAVFGVLQGGKGDQPSVSNISIEVITEIFEAARKPAVAAIHGLALGGGLEV
AMACHARISTPTAQLGLPELQLGIIPGFGGTQRLPRLVGLSKALEMMLTSKLIKGQEAHS
LGLVDDIAPPEELITTARKRALEILEWRRPWVHSLHRTDKLESLAEAKEIFETARVQARK
QSPNLKHPFACIDVIEMGVVFGPRAGLRKEVEEFQGLLHTDTCKSLIHIFFAQRSTTKVP
GVTDLGLAPRKITKVAIVGGGLMGSGIATALILSNYPVILKEVNDEFLQAGIDRVRANLQ
SRVEKGNMTKENFEKTISLLKGVLDYESFKDVDMVIEAVTENVSLKQQIFADLEKYCPPH
CMLATNTSTIDLELIGERTKSCDRIIGAHFFSPAHVMPLLEIVRTKHTDEQVIVDLLDVG
KTIKKTPIIIGNCTGFAVNRMFFPYSQAAILLAERGVDPYRIDREISKFGMPMGPFRLCD
LVGFGVAEAATSQFVQDFPERTYKSVLIPLMQEDKNAGESTRKGFYVYDQNRKAGPNPEL
KSYIEKARSTSGISVDPKLMKLSEKDIVEMILFPVVNEACRVLAEGIAVKAADLDIAGVM
GMGFPSYRGGLMFWADSLGSNYIYSRLEEWSKQYGGFFKSCGYLAERATQGATLVRNLHA
NLTELIFRAPKSSSLIHLPHKSRAEL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaatgcaaaaggaagaacagagatggaggtgggagatgatggagttgctata
atcaccatcatcaaccctccagttaacgccttgtcttttgatgtattattcagcctaaga
gatagttatgaacaagccatgaaaagagatgatgtgaaggcaattgttgtcacaggtgca
atggggaagttttctggtggctttgatatagctgtttttggtgtactccaaggaggaaag
ggggaccaaccaagtgttagcaacatatcaattgaagttatcactgaaatttttgaagct
gcccgaaagcctgcggttgcagcaatccatgggcttgctttgggtggaggtttagaggtt
gcaatggcctgtcatgctcgaatatcgactcctaccgctcaactaggtttgcccgaactt
cagcttggaataattcctggttttggaggaacacaacggcttccacgtctcgttggtctc
tcaaaggctctagaaatgatgttgacatcaaagctaattaaaggacaagaagctcattct
ttggggcttgtcgatgacattgcccctcctgaagagttgatcacgactgcacgtaaacgg
gctctcgaaatcctagagtggagaaggccatgggttcatagtctccataggactgacaag
ttagagtcccttgccgaggctaaggaaatatttgagactgccagagttcaggcaaggaaa
cagtcaccgaatcttaagcacccgttcgcctgcattgacgtcattgaaatgggtgtcgtc
tttggccctcgtgctggacttcggaaggaggttgaagaatttcagggactcctacatact
gatacttgtaaaagcttaattcatatcttctttgcccagcgttcgacaacaaaggtaccc
ggggttaccgatcttggtttggcaccgagaaaaatcacgaaagttgctatcgtgggagga
ggattaatgggatctggaatagctacagcattgattcttagcaactatcctgtaatactc
aaagaagtgaacgatgagttcttgcaggctggcattgatagagtcagggcgaacctacaa
agccgagtcgaaaaagggaatatgactaaagagaattttgagaagactatttctttactc
aagggagttcttgactatgaaagttttaaagatgtggatatggtgatagaggctgttacc
gagaatgtttctttgaagcaacagatctttgctgatcttgagaaatattgcccaccacat
tgtatgcttgctactaatacttccacaatagatttggagttgattggagagagaacgaag
tcttgtgacagaattattggagcccatttcttcagtcccgcccatgtcatgccactattg
gaaattgttcgtaccaagcatacagatgaacaagtaattgttgatctgctagatgttggg
aagactataaagaaaacgcctattatcattggaaattgcacaggatttgctgtgaacaga
atgtttttcccctactctcaggctgccattttacttgccgagcgtggagtagatccctat
cgaattgatagggaaatttccaagtttggaatgccaatgggacccttcaggttgtgtgac
ctcgttggtttcggtgtggcagaagcagctaccagtcagtttgttcaagattttccagaa
agaacttataaatctgtgctaattcctcttatgcaagaggataagaatgcaggtgaatcc
actcgtaaaggtttctatgtctatgaccagaaccgtaaagctgggccaaatccggagtta
aagagttatattgagaaggctcggagcacttccggtatttcagttgatcctaagctaatg
aagttatcggaaaaggacattgtggagatgatattattcccggtggtgaatgaggcatgc
cgtgtcctagcagaaggcatagcggtcaaagcagccgacctggacattgctggtgtaatg
ggaatgggtttcccctcttacaggggagggctcatgttctgggcggattctcttggatca
aattacatctattcaagattggaggaatggtcgaaacagtatggtggatttttcaagtct
tgtggatacttggctgaaagagctactcagggtgcaactctggtgagaaatttacatgct
aatttaaccgagcttattttccgtgcacctaaatcctcatctcttatacatctcccacat
aaatcaagagctgaactctag

DBGET integrated database retrieval system