KEGG   Cucurbita moschata (crookneck pumpkin): 111461986Help
Entry
111461986         CDS       T05248                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111461986
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111461986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111461986
NCBI-ProteinID: XP_022961402
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVAVLGNSECVVGTIFFSQEGDGPTTVTGDVSGLKAGLHGFHVHAMGDTTNGCMSTG
PHFNPAGKQHGAPEDENRHAGDLGNITVGEDGKASFTITDNQIPLSGPNSIIGRAVVVHA
DPDDLGKGGHELSLSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggctgttcttggaaatagcgagtgtgttgttggaactatctttttc
tcccaagaaggagatggtccaaccactgttacgggcgatgtttctggtctcaaggctggg
cttcatggattccatgttcatgccatgggtgacacaactaacggctgcatgtcaactgga
ccacatttcaaccctgctggaaaacagcatggtgctcccgaggatgagaatcgccatgct
ggtgatttagggaacattactgttggtgaagatggaaaggctagctttaccattactgat
aaccagattcctctctctggacctaactccattatcggaagggctgttgtagtccatgct
gaccccgacgatcttggcaagggtggacatgaactcagcttatctactggaaatgctggt
gctagagtagcctgtggcattattgggcttcaaggttga

DBGET integrated database retrieval system