KEGG   Chamaesiphon minutus: Cha6605_0643Help
Entry
Cha6605_0643      CDS       T02414                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00630  Glyoxylate and dicarboxylate metabolism
cmp00710  Carbon fixation in photosynthetic organisms
cmp01100  Metabolic pathways
cmp01120  Microbial metabolism in diverse environments
cmp01200  Carbon metabolism
Module
cmp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cmp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cmp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cha6605_0643
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cha6605_0643
Enzymes [BR:cmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cha6605_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY91920
UniProt: K9UAQ5
LinkDB All DBs
Position
complement(693832..694152)
Genome map
AA seq 106 aa AA seqDB search
MQTLPFARRFETFSYLPPLSDAQIAKQLQYMLDQGYIPGVEFSQDSEPTQHYWTLWKLPL
FNATTTNEILAEVRACRSEYGHCFVRVVGFDNIKQCQVLSFIVHKP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttacctttcgcccgtcgctttgagactttttcctacttgccaccattgagc
gatgctcaaattgctaaacaactgcaatatatgctcgatcaaggctatattcctggtgtt
gagttcagccaagattcagagcctacccagcactactggacactttggaagttaccttta
ttcaacgctactactactaacgaaattttagctgaagtgcgtgcttgccgtagtgaatac
ggtcattgtttcgttcgggttgttggttttgacaacatcaaacagtgtcaagttttgagc
tttatcgttcacaagccatag

DBGET integrated database retrieval system