KEGG   Chamaesiphon minutus: Cha6605_3070Help
Entry
Cha6605_3070      CDS       T02414                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00010  Glycolysis / Gluconeogenesis
cmp00020  Citrate cycle (TCA cycle)
cmp00620  Pyruvate metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01120  Microbial metabolism in diverse environments
cmp01130  Biosynthesis of antibiotics
cmp01200  Carbon metabolism
Module
cmp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cha6605_3070
   00020 Citrate cycle (TCA cycle)
    Cha6605_3070
   00620 Pyruvate metabolism
    Cha6605_3070
Enzymes [BR:cmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cha6605_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFY94093
UniProt: K9UHG8
LinkDB All DBs
Position
complement(3221836..3223131)
Genome map
AA seq 431 aa AA seqDB search
MAIHEVFMPALSSTMTEGKIVSWQKSPGDKVEKGEIVVVVESDKADMDVETFYSGYIATI
VVPAGESAPVGSAIALVAETQAEIEVAKQQAQGKSSAATATAPTTTSAPAATAAATTIAP
PATTATPAAAPLRSDRPVVSPRARKLAKEYGVAVETLNGTGPNGRITAEDVGTAAGKPQA
APGHSQPATPVAAPTFVPPAAPAIAAVAGSVVPFTTLQSAVTRNMMASLSVPTFRVGYTI
ETNNLDKLYKQIKDKGVTMTALLAKAVAMTLAKHPIVNASYTDAGINHPGSINIAVAVSM
PDGGLITPVLQNADKLDLYSLSRMWKDLVDRARSKQLQPQEYSSGTFTISNLGMLGVDRF
DAILPPGTGAILAVGASQPQVVASEDGTFAIRRQMQVNMTADHRIIYGADAANFLKDLAL
LIQTNAQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacacgaagttttcatgcctgctctaagttcgactatgactgaaggcaagatc
gtctcttggcaaaaatcgccaggggacaaagttgaaaaaggtgaaatcgttgtcgtggtc
gaatccgacaaagccgatatggacgtggaaaccttttatagcggctatattgcgacgatc
gtcgtcccagccggagagtccgcaccagtcggatcggcgatcgcgttagtggccgaaact
caagctgaaatagaagtagccaagcagcaagcccaaggcaaatcttcagccgcgacggcc
actgcccccacgacaacatcggcaccagccgccaccgccgcagctaccacgatcgcgccc
ccagccacaactgcaactccagcagcagctccactcagaagcgatcggcccgtagtttcc
cctcgtgcgaggaaattagccaaagaatacggcgttgctgtcgaaactcttaatggtact
ggccccaatggtcggattacggcagaagatgtcggtaccgctgctgggaaaccgcaagca
gctcccggtcacagccagccagcaacaccagttgctgcacccacattcgtaccgcctgct
gctcccgcaatcgcagcggtagctggcagcgtagttccctttacaaccctccaatccgcc
gtcactcgcaacatgatggcgagcctttcggtaccgacattccgcgtcggctacacgatc
gaaaccaacaatctcgataaactttataaacaaattaaagataagggcgttaccatgacg
gcactgctagccaaagcagtcgccatgacccttgcgaaacatccgatcgttaatgctagc
tacaccgatgcaggcattaaccatcctggctcgattaacatcgccgtcgccgtctcgatg
cccgatggcggtttgattacccccgtcctccaaaatgccgataaactcgacctttactcc
ctctcgcggatgtggaaagatctagtcgatcgggcgcggagcaagcagttacagcctcaa
gagtatagctctggcacctttaccatctccaacctcggaatgctcggtgtcgatcggttt
gatgccattctaccccccggtacgggcgcaattttggcagtcggtgcatcccagccgcaa
gtagtggctagcgaagatggtacgtttgcgatccggcgtcaaatgcaggtaaatatgact
gccgatcatcggattatctatggtgccgatgcagctaatttcctcaaagatttggctctg
ttaattcaaactaacgctcaatctttgacattatag

DBGET integrated database retrieval system