KEGG   Chamaesiphon minutus: Cha6605_3070
Entry
Cha6605_3070      CDS       T02414                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00010  Glycolysis / Gluconeogenesis
cmp00020  Citrate cycle (TCA cycle)
cmp00620  Pyruvate metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01120  Microbial metabolism in diverse environments
cmp01200  Carbon metabolism
Module
cmp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cha6605_3070
   00020 Citrate cycle (TCA cycle)
    Cha6605_3070
   00620 Pyruvate metabolism
    Cha6605_3070
Enzymes [BR:cmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cha6605_3070
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AFY94093
UniProt: K9UHG8
LinkDB
Position
complement(3221836..3223131)
AA seq 431 aa
MAIHEVFMPALSSTMTEGKIVSWQKSPGDKVEKGEIVVVVESDKADMDVETFYSGYIATI
VVPAGESAPVGSAIALVAETQAEIEVAKQQAQGKSSAATATAPTTTSAPAATAAATTIAP
PATTATPAAAPLRSDRPVVSPRARKLAKEYGVAVETLNGTGPNGRITAEDVGTAAGKPQA
APGHSQPATPVAAPTFVPPAAPAIAAVAGSVVPFTTLQSAVTRNMMASLSVPTFRVGYTI
ETNNLDKLYKQIKDKGVTMTALLAKAVAMTLAKHPIVNASYTDAGINHPGSINIAVAVSM
PDGGLITPVLQNADKLDLYSLSRMWKDLVDRARSKQLQPQEYSSGTFTISNLGMLGVDRF
DAILPPGTGAILAVGASQPQVVASEDGTFAIRRQMQVNMTADHRIIYGADAANFLKDLAL
LIQTNAQSLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcaatacacgaagttttcatgcctgctctaagttcgactatgactgaaggcaagatc
gtctcttggcaaaaatcgccaggggacaaagttgaaaaaggtgaaatcgttgtcgtggtc
gaatccgacaaagccgatatggacgtggaaaccttttatagcggctatattgcgacgatc
gtcgtcccagccggagagtccgcaccagtcggatcggcgatcgcgttagtggccgaaact
caagctgaaatagaagtagccaagcagcaagcccaaggcaaatcttcagccgcgacggcc
actgcccccacgacaacatcggcaccagccgccaccgccgcagctaccacgatcgcgccc
ccagccacaactgcaactccagcagcagctccactcagaagcgatcggcccgtagtttcc
cctcgtgcgaggaaattagccaaagaatacggcgttgctgtcgaaactcttaatggtact
ggccccaatggtcggattacggcagaagatgtcggtaccgctgctgggaaaccgcaagca
gctcccggtcacagccagccagcaacaccagttgctgcacccacattcgtaccgcctgct
gctcccgcaatcgcagcggtagctggcagcgtagttccctttacaaccctccaatccgcc
gtcactcgcaacatgatggcgagcctttcggtaccgacattccgcgtcggctacacgatc
gaaaccaacaatctcgataaactttataaacaaattaaagataagggcgttaccatgacg
gcactgctagccaaagcagtcgccatgacccttgcgaaacatccgatcgttaatgctagc
tacaccgatgcaggcattaaccatcctggctcgattaacatcgccgtcgccgtctcgatg
cccgatggcggtttgattacccccgtcctccaaaatgccgataaactcgacctttactcc
ctctcgcggatgtggaaagatctagtcgatcgggcgcggagcaagcagttacagcctcaa
gagtatagctctggcacctttaccatctccaacctcggaatgctcggtgtcgatcggttt
gatgccattctaccccccggtacgggcgcaattttggcagtcggtgcatcccagccgcaa
gtagtggctagcgaagatggtacgtttgcgatccggcgtcaaatgcaggtaaatatgact
gccgatcatcggattatctatggtgccgatgcagctaatttcctcaaagatttggctctg
ttaattcaaactaacgctcaatctttgacattatag

DBGET integrated database retrieval system