KEGG   Chamaesiphon minutus: Cha6605_3362Help
Entry
Cha6605_3362      CDS       T02414                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00500  Starch and sucrose metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cha6605_3362
Enzymes [BR:cmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cha6605_3362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: AFY94364
UniProt: K9UJJ5
LinkDB All DBs
Position
complement(3532057..3534615)
Genome map
AA seq 852 aa AA seqDB search
MQPIRTFNVSPSLPASLEPLRQLAYNLYWDWNTEIKELFRRLDRDLWEATRHNPVALLAR
VSQSRLQEVAADDGFLAHMERAVGELNTYLHDRSWYKHKRANNVGKECFAYFCAEFGLVD
CLPIYSGGLGVLAGDHLKSASDLGLPLVAVGLLYQKGYFAQYLNAEGWQQERYPVNDFHN
IPVQLERKPDGSELRIAVEYPGRMVYARVWRVQVGVVPLYLLDTNIEPNSAYDQDITDAL
YGGDLDTRIHQEIMLGIGGFRALEALGHKPSVYHMNEGHSGFLILEHIRVLMQRDGLSFV
EARQVAQSTQIFTTHTPVSAGFDLFPPDKTIYYVGHYAGIYGLSKDDFMGLGRENAADLN
SPFSMAALAMKTSSFVNGVAKLHGVVSREMFQNMWKDVPIDEVPITSVTNGVHARSCVAK
SVQELYDRYLGPEWSEKSIEDPIWHKMDAIPDEELWRNHEHSRSEMVVYVRDRIVSHLKE
RGATLAEINHAQEALDPGVLTIGFARRFATYKRATLFLRNLERIKKILVGNKERKVQFVI
AGKAHPKDIPGKALIRDIVHFTRSEGMNSVVFVPDYDIYVSRVMVAGCDIWLNTPRRPHE
ASGTSGMKAAMNGLPNLSILDGWWDEADYVRTGWPIGHGELYSDEDYQDSVEANAFYDLL
EQEIVPLFYDRDKEGLPRKWIAKMKDAIRLNCPTFNTARMLRDYATVGYFPASDRNHVVT
DNHYQAGKDLAHWKQKMLKHWGDLKVHTVDVSAPEDINVNQSISVKSLIQLGSLEPHDVQ
VELYKGAVDTNGKIVNADTTVMTYQGRDGNGNSLYTSEIAYAASGLQGLSLRVLPHHPHL
SNPYELGSILWA
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgattcgtacattcaacgtttctccttccctaccagcctcactcgaaccccta
cggcagcttgcctataatctgtattgggactggaatacggagatcaaagaactatttaga
agactcgatcgggatttgtgggaagctacccgtcacaacccagtcgctctattagctaga
gtcagtcagtcgcgcttgcaagaagttgctgctgatgatggttttctagctcacatggaa
cgcgcagtaggcgaactcaatacctacttacacgatcgcagttggtacaaacacaaacgt
gccaataatgtcggcaaagaatgctttgcttatttctgtgctgaatttggattagtagac
tgtctgccgatctactctggcggtttgggcgtgctggcgggagatcacctcaagtcagct
agcgatttaggtttacccctagttgccgtcggtttgctataccaaaaaggctactttgcc
caatatctcaatgccgaaggctggcaacaggaacgttatccagttaacgattttcacaat
atccccgttcaactcgaacgcaaacccgatggctccgaactacgcatagcggtagagtat
cccggacggatggtgtatgccagagtctggcgcgtgcaagtgggtgtggttccgctctac
ttgctcgataccaatatcgagccaaatagtgcttacgaccaagatattaccgatgccttg
tatggtggcgatttagatacgcgcattcatcaagaaatcatgttagggatcggcggcttc
cgcgcgctcgaagcgttgggacacaagccgagcgtctatcacatgaatgaaggacactcc
ggcttcctgattctcgaacacattcgggtgctgatgcaacgcgatggcttatcctttgtc
gaagcccgacaagtcgcgcagtctactcagattttcacaacgcatacgcctgtgagtgcg
ggattcgatctgttccctccagacaagacgatctattatgtcggtcattatgctggcatt
tacggactgagtaaagatgactttatgggcttgggacgcgaaaatgcggcggatttaaat
tcgccctttagcatggcagctctggcgatgaagacttctagctttgtcaacggtgtggcg
aagttgcacggcgtcgtctcgcgggaaatgttccaaaacatgtggaaagatgtccccatc
gacgaagtaccgattacgtcggtaactaatggcgtccacgcccgcagttgcgtcgccaaa
tccgtgcaagaattgtacgatcgctatttaggcccagagtggtcggaaaaatcgatcgaa
gatccgatttggcacaaaatggacgcgattcccgatgaggaactgtggcgcaatcacgaa
cacagtcgatcggaaatggtcgtctacgttcgcgatcgcatcgtcagccatctcaaagaa
cgcggcgcgactttagctgaaatcaaccacgcgcaagaagcactagatccaggcgtcttg
acgatcgggtttgccagacgatttgcgacatacaagcgcgcgacattattcttacgcaat
ttagagcggattaaaaagattttagtcggcaataaagaacgtaaagttcaatttgtaatc
gcaggtaaagcccaccccaaagatatacccggtaaggcactaatccgcgatatcgtccac
ttcacgcgctccgaaggcatgaactcagtcgtattcgtccccgactacgatatttatgtc
tcgcgagtgatggtagctggttgcgacatttggctgaatacgccccggcgtccgcacgaa
gcttctggtaccagcggcatgaaagcggcaatgaatggcttacccaacctgagtattctc
gatggttggtgggatgaagccgattacgtccgcacgggttggccgatcggtcacggcgag
ctatactccgatgaagattatcaagatagcgtcgaagccaatgctttctacgacctgtta
gaacaagaaatcgtccccttattctacgatcgagacaaagaaggcttacctcggaaatgg
atcgccaagatgaaagatgccatccggctcaattgtccgaccttcaataccgcccggatg
ctgcgggattatgcgactgtgggttatttccccgccagcgatcgcaaccatgtcgtcacc
gacaatcattatcaagctggtaaagatctcgcccattggaaacaaaagatgctcaaacat
tggggcgacctcaaagtccataccgtcgatgtctccgcaccagaagatattaacgtcaat
cagtcgatctccgtcaagagtctgattcaactaggaagtttagaacctcacgacgtccaa
gtcgaattgtacaaaggtgccgtagacaccaatggcaaaatcgtcaacgcagacaccact
gtaatgacctatcaaggccgggatggcaacgggaatagtctgtacaccagtgagattgct
tacgctgctagcggcctgcaaggcttgtctctgcgcgtgttgcctcaccacccacatttg
agcaatccttacgaactcggatcgattctgtgggcgtag

DBGET integrated database retrieval system