KEGG   Chamaesiphon minutus: Cha6605_3906Help
Entry
Cha6605_3906      CDS       T02414                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00380  Tryptophan metabolism
cmp00630  Glyoxylate and dicarboxylate metabolism
cmp01110  Biosynthesis of secondary metabolites
cmp01130  Biosynthesis of antibiotics
cmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cha6605_3906
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Cha6605_3906
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Cha6605_3906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AFY94872
UniProt: K9UIE6
LinkDB All DBs
Position
complement(4105302..4107470)
Genome map
AA seq 722 aa AA seqDB search
MSEQHPVNEQSKDRSLENYRVEPGQKLTTDEGHPLSNTDDSLKAGGRGPTLLEDFHFQQK
LSAFDRERIPERVVHARGAGAHGYFEPYESMAEFTKAKFLGDPAVKTPVFVRFSTVGGSR
GSADAVRDVRGFSVKFYTEDGNYDIVGNNIPVFFIQDAIKFPDIIHAVKPEPDNEMPQAS
TAHPSFWDFISLVPESMHMIMWLLSDRTLPRNFSTMQGFGVHTFRWVNKEGKSRFVKYHW
KPLAGVHSNVFDEAQKIAGKDPDFQRRTLWESIEKGNYPEYELGVQIVEEEDEHKFDFDI
LDSTKMIPEELVPVRPIGKMVLNRNPDNFFAETEQVAYQPSNVVPGIDFSDDPLLQGRLM
SYHDTQLHRLGSPNFVHLPINRPVCPFSNNNQDGRMQMDIKTSRVNYSPNSLGGNLPAPV
APEDGGFVTYPERVEGHKIRERSPSFSDHFSQATLFWNSLSKGEKDRLVEASHFELGKVK
NKEVQARMIERFNNVDHELAKRVAIGLGMPAPAAPATENHGRSSAALSQENTTKTAKGRH
VAILAADGVDGAQLATLKHALSAMSISADIVSKMGGTIASADGNSSIEVDKTFLTTASVL
YDAVYVPGGSQSIEALKAHGEALTFIHEAFKHFKPIAGSGEGVDLLMQADLKGIDAAQVN
GKMSAQLGVIASRDVSEMGKFATAFIDAIKEHRFWTRPIPGTASVEAEAEKLMMQQMERA
SA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaacatccagttaacgagcaaagcaaagatcgaagcctagaaaactatcgc
gtagaacccggtcaaaaactaactaccgatgagggtcatccacttagcaacacagatgat
tcgctcaaagctggtgggcgcgggccgacactgctcgaagattttcactttcaacaaaag
ttgtcagcattcgatcgcgagcgcatccccgagcgggtggttcacgcacgcggtgcgggc
gcacacggatacttcgagccatatgagtcgatggccgaatttaccaaagccaagttttta
ggagacccagccgtcaaaacgcctgtattcgtgcggttctcgaccgttggcggctcgcgc
ggttctgcggatgccgtccgcgacgtgcgggggttttcggtgaagttttacaccgaagat
ggcaactatgacatcgtcggcaataacattccggtgttctttattcaggatgccattaag
tttcccgatatcatccatgcggtgaaacccgaacccgataatgagatgccccaggcatca
accgcgcatccaagcttctgggactttatttccttagtgccagaatcgatgcacatgatt
atgtggttgctatccgatcggacattaccgcgtaatttcagcaccatgcaaggctttgga
gtgcatacattccgctgggtcaacaaagaaggcaagtcccgctttgtgaagtaccactgg
aaaccattagcgggcgtacactccaacgtttttgatgaagcccaaaagattgcaggtaaa
gatcccgatttccaacgccggacgttatgggaatcgatcgaaaaaggtaactatcctgag
tacgaattaggcgtccagattgttgaagaagaagacgaacacaagtttgacttcgacatt
ttggattcgacaaaaatgattcccgaagaattggtgccagttcgcccgatcggtaaaatg
gtactcaaccgtaaccccgataacttcttcgccgaaaccgaacaagttgcttaccaacca
tcaaatgtggtgccagggattgactttagcgacgacccactgttgcagggtcgtttgatg
tcctaccacgacacgcaactacatcgcttgggcagtcccaacttcgttcatttgcccatc
aaccgtcccgtttgtccgtttagtaacaacaatcaagacggacggatgcagatggatatt
aaaaccagtcgggtgaattactcgcccaactcgctcggcggcaatctccccgcgcccgtt
gcgcccgaagatggtggttttgtgacttacccagagcgcgtcgaagggcataagattcgc
gaacgcagtccgagcttctccgaccacttctcacaagcgactctgttctggaacagtctt
tctaaaggcgagaaagatcgcctcgtcgaagccagtcacttcgagctgggtaaagtcaag
aataaagaagtccaggcgcggatgatcgagcgtttcaacaacgtagaccatgagttagcc
aagcgcgttgccatcggtttgggaatgcccgcacccgccgctcccgccaccgaaaaccac
ggtcgctcgtcggcagccctgagccaagaaaacaccaccaagactgctaaaggtcgtcat
gtcgcaatcttagccgccgatggcgtagatggcgcacagttggcaacgctcaagcacgcc
ttaagtgcgatgagtatctccgcagatatcgtatcgaaaatgggtggcacgatcgccagt
gctgacggtaattcgtcgatcgaagtcgataagacgttcttaacgacagcttcggtactt
tacgatgcagtctatgtgcccggtggatctcagagcatcgaggctttaaaggctcacggt
gaggctttaactttcattcatgaggcattcaagcattttaaaccgatcgcgggttctggt
gagggtgttgacttactgatgcaggcagatctcaaagggatcgatgcggctcaggtgaat
ggtaagatgagcgcgcagttgggtgtaattgccagccgcgatgtttcggagatgggtaag
tttgcaacggcgtttatcgatgcgattaaggaacatcggttctggacgcgtccgatcccg
gggactgcttcggttgaagctgaggctgaaaagttgatgatgcagcagatggagcgcgct
tcggcgtag

DBGET integrated database retrieval system