KEGG   Chamaesiphon minutus: Cha6605_4003Help
Entry
Cha6605_4003      CDS       T02414                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00970  Aminoacyl-tRNA biosynthesis
cmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cha6605_4003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cmp03029]
    Cha6605_4003
Enzymes [BR:cmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cha6605_4003
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cha6605_4003
Mitochondrial biogenesis [BR:cmp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cha6605_4003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFY94965
UniProt: K9UJG7
LinkDB All DBs
Position
complement(4218630..4220078)
Genome map
AA seq 482 aa AA seqDB search
MASIRELHHQLVTKERSAVEIATEAIARVEQLEPKLRSFLCTTPTQALAQARSVDAKIAA
GEQIPLLAGIPIALKDNMCTQGIVTTCGSKILAGFIPPYESTVTQKLQDLGAVSLGKTNL
DEFAMGSSTENSAYQVTANPWDLERVPGGSSGGSAAAVSGSECVVSLGSDTGGSIRQPAA
FCGVVGLKPTYGLVSRFGLVAYASSLDQIGPFARTVEDAAILLEAIAGYDPKDSTSLKIE
IPKYSQLLTPDLPKGLKIGVITETFGEGLDPQVAESVHQAIEHFRALGAEVREISCPRFR
YGLPTYYVIAPSEASANLARYDGVKYGFRAEADNLMSMYTQTRAAGFGAEVKRRIMLGTY
ALSAGYYDAYYLKAQKVRTLIKEDFEVAFSEVDILITPTAPTTAFKAGEKTADPLSMYLS
DLMTIPVNLAGLPGISIPCGFDDKGMPIGLQLLSNVLREDLLLQVAHVYEQTNEWYKRSP
SL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcatctattcgtgagttgcaccaccagcttgttaccaaagaacgatcggcagtagaa
atcgccaccgaagcgatcgcgcgagtcgagcaactcgaacctaaactgcggagtttctta
tgtaccacaccgacacaagctctggcacaggcacgatcggtagacgccaaaattgccgca
ggtgaacaaattcccctcctagcgggtattccgatcgcactcaaggataacatgtgtacc
caaggcatcgtgactacctgcggttccaaaattctcgctggcttcataccgccttatgag
tctactgtcacccaaaagctgcaagatttaggcgcggtatccttgggcaaaactaacctc
gatgaatttgcgatgggtagttctaccgaaaactctgcctaccaagtcaccgccaatcct
tgggatctagaacgcgtaccgggcggatcttcaggtggttcggctgcggctgtatcgggt
tcagaatgcgttgtatcgctcggttccgatactggcggttcgattcgtcaacctgcggct
ttttgtggcgtggtgggtctaaaaccgacctatggattggtatcgagattcggactggtg
gcttatgcctcctcgctcgatcaaattgggccatttgcgcggacggtagaagatgcagcc
atactattggaagcgatcgcgggttacgatcctaaagattccaccagcctaaagattgag
attcccaagtattcccaactattgaccccagacttaccaaagggtcttaaaatcggcgtc
attaccgaaacttttggcgaaggtttagatccgcaagttgccgaatccgtccatcaagcg
atcgagcattttcgcgctttgggtgccgaagttcgagaaatttcctgtccgcgtttccgc
tacggtttacccacctattatgtgatcgctccttccgaagcctcggcaaacctagctcgc
tatgatggcgtcaaatatggatttagagccgaagctgacaatctgatgtccatgtataca
caaactagggctgctggatttggtgccgaagtcaaacgacggattatgctgggtacctac
gcgctttcggctggttattacgatgcctactacctcaaagctcaaaaggtacgaacgcta
attaaagaggactttgaagtagcctttagtgaggtagatattttaattacccctaccgcc
ccgacgacggcttttaaagctggcgaaaaaactgccgaccccttgagcatgtatctctct
gacttgatgactatccccgtcaatctcgctggattgcctggaattagtatcccctgtggt
ttcgacgataagggaatgccgatcggtttgcagttgctcagtaatgtattacgcgaggat
ctcttgctgcaagtcgctcacgtttacgagcagacaaatgaatggtataagcgatctcct
agtttatag

DBGET integrated database retrieval system