KEGG   Chamaesiphon minutus: Cha6605_5443Help
Entry
Cha6605_5443      CDS       T02414                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00620  Pyruvate metabolism
cmp00680  Methane metabolism
cmp00710  Carbon fixation in photosynthetic organisms
cmp01100  Metabolic pathways
cmp01120  Microbial metabolism in diverse environments
cmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cha6605_5443
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cha6605_5443
   00680 Methane metabolism
    Cha6605_5443
Enzymes [BR:cmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cha6605_5443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY96329
UniProt: K9UQ46
LinkDB All DBs
Position
complement(5753564..5756590)
Genome map
AA seq 1008 aa AA seqDB search
MQPLTHMLEPELMVSTPSNLLLNHRLKVIEDLWERVLRDACGQELVNLLNQLREMCSSDG
SAAEPLPQAVHVLIEKLDLKDAIRAARAFALYFQLINIVEQHYEQCEQKLALKLSLQYSV
PIHAAPQTDRASEHVAPLGAGLLEKTWQASSVEQQKDRGTFAALFPLLKAAGVPPQQVQR
LFDELDIGLVFTAHPTEIVRHTIRDKQRRVAQILEKLDRAEEDMTRLGIQSSWEVAELEG
QLLEEILLWWRTDELHQFKPTVLDEVDYTLHYFEEVLFDAIPQLSQRLNLALKQSFPYLT
PPSNRFCRFGSWVGSDRDGNPSVTPKVTWQTACYQRGIVLKKYIKCTRALTNALSLSLHW
SNVLPELLESLEQDKSHFPEIYEDWAIRYRQEPYRLKLTYIIKRLSNTLDRSRQVSDWDS
LQFPKADLNPNTCYHSGADFLKELRLIRQSLQQTGLTCQALETLICQVEIYGFNLAQLDI
RQESGRHADTIAEITEYLQVFPKSYHDLSETERVEWLVGELKTRRPLIPGELPFSPKAVE
TIETFRMLRRLHQEFGPEICQTYVISMNRDVSDILEVMLLGKESGLYDPATGITSLQVVP
LFETVEDLKKAPLVMQSLFELPLYRAALTGGYQPTPANAIPGLVPHLQEVMLGYSDSNKD
AGFLSSNWEIHKAQKALQAIAEKFNVKLRIFHGRGGSVGRGGGPSHEAILAQPGQSINGR
IKITEQGEVLASKYSLPELALYNLEQVASAVIKTSLMSGGVDDIEPWNEVMEDLADRSRR
HYRALVYDRPELVNFFHQVTPIDEISHLQISSRPARRGGKRDLASLRAIPWVFSWTQSRF
LLPSWYGVGTALEEFVAECPQENFELLQGFYRKWPFFRMAISKVEMTISKVDLQIARHYM
EELSQPEDREQFEILFERIAHEYRLVSDLVLRISGHERFLDDNPELQRSIQLRNGSIVPL
GFLQVSLLKRLRQHGGAGMIYSRYSKRELLDGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgctaacccacatgttagaaccagaattgatggtttcaactccatccaatctc
ttactaaatcatcgactcaaggtaatcgaagacctgtgggagcgcgtgctgcgagatgct
tgcgggcaagaattagtcaatctgctcaatcagttgcgggagatgtgttcctccgatggc
agtgctgccgaacctttaccacaagcggtacacgtcctgatcgaaaaactcgatctcaaa
gatgccattcgtgctgctagagccttcgcgctttattttcaattaattaatattgtcgag
caacactacgagcagtgcgaacaaaaactagctctaaagttgtcgctccagtattcggtg
ccgattcatgcggccccacaaaccgatcgcgcgtccgaacatgttgcccctctaggtgcg
ggtttgctcgaaaaaacttggcaggcttcttctgtagagcagcaaaaagatcgcggtacc
tttgcggctttatttcctttgctcaaagccgccggagtgccaccccaacaggtgcagcga
ttgttcgatgagttggatatcggtttagtctttaccgcccatccgaccgaaattgtgcgg
cataccattcgcgataagcaacgacgggtagcgcagattttggaaaaactcgatcgtgcg
gaagaggatatgacacggttgggaattcaatcttcttgggaagtcgccgaactagaagga
caattactcgaagagattttattatggtggcggacggatgaattacaccaattcaagccg
acagttttggatgaagtagactataccctccattactttgaagaagtattattcgatgcg
attccgcagttgtcacaacgcttgaatttggctctcaagcagtcttttccctatctgacg
ccgccgagcaatcgcttttgtcggtttggttcgtgggttggctccgatcgcgatgggaat
ccgtcggttactcccaaagttacttggcaaactgcgtgctatcagcggggaatcgtcctt
aaaaaatacatcaaatgtacgcgtgcattaaccaatgccctgagtctatccctacattgg
agcaacgttttacctgagttattagagtccctagaacaggacaaatcccattttcccgaa
atctatgaagattgggcaatccgctatcgtcaagagccgtatcgactcaaattaacttat
attatcaagcggctctcgaacacgctcgatcgatctcgtcaagtctcggactgggatagt
ttacagtttcccaaggccgacctcaaccccaatacctgctatcactcaggtgccgacttt
cttaaggaattaaggctgatccgccaaagtttgcagcaaaccgggttgacttgtcaagcc
ttggagacattaatttgtcaggtcgaaatctacggctttaatctggcccaactcgatatc
cgtcaagaaagcggtcgtcatgctgacacgatcgccgaaattaccgaatacctccaagtc
tttcccaagtcttaccacgatctctcggaaaccgaacgggttgaatggttagttggcgaa
ctcaaaactcggcgtccgttaattcctggcgaactcccattttcgcccaaagctgtcgag
acgatcgaaaccttccggatgttacgccgcctccatcaagaatttggccccgaaatctgc
cagacatatgtaattagtatgaaccgagatgtcagtgacattctcgaagtaatgctcctg
ggcaaagaatccggcttgtatgaccccgcgacggggattaccagtctccaagtggtaccg
ctatttgaaaccgtcgaagaccttaaaaaagctccgctcgtcatgcaatctctatttgaa
ttgcccctgtaccgtgcggctctgactggcggctatcagcccacacccgcaaatgccatc
cctggcttggtgccacatctccaagaggtaatgctgggctactccgatagtaataaggat
gcaggcttcctcagcagtaactgggaaattcacaaagcccaaaaagccctccaagcaatc
gccgaaaaattcaacgtcaagctgcggatttttcacgggcgcggcggcagcgtcggtcgc
ggcggcgggccatctcacgaggcgattttggctcagccaggacagagtatcaacggtcga
atcaagattaccgaacaaggcgaagttttggcatccaaatattctttgccagagctagct
ttatacaacttagagcaagtagctagtgcggtgatcaaaaccagtctgatgtctggcggt
gtcgatgatatcgaaccatggaatgaggtaatggaagatctcgcagatcgatcgcgccgt
cactatcgcgcgctcgtttacgatcgaccagagctggttaatttctttcatcaggtcacc
ccgatcgatgaaatcagccatctccaaattagttcgcgcccagctcggcgcggcggtaaa
cgcgatctcgcaagtctccgggcgattccgtgggtatttagctggacgcaaagtcgtttc
ctgctgccttcctggtatggtgtcggtaccgcactagaggaatttgttgccgaatgtccc
caagaaaacttcgagttgctccaaggcttttatcgtaaatggccatttttccggatggca
atttccaaagtagagatgactatttctaaagtcgatctgcaaatcgcgcgccactacatg
gaagaactctcgcaaccagaagatcgcgagcaatttgaaatcctattcgagcggatcgct
catgaatatcgactcgtcagcgatctcgtactgcggatttccggacacgaacgctttcta
gatgacaatcccgagctgcaacgttctattcagctacggaatggtagcatcgttccgtta
ggatttctacaagtctcactactcaaacgtctgcgccaacacggcggtgcagggatgatt
tattctcgctacagcaagcgagaactcctcgatggggcattgctaaccatcaacggcatt
gccgctggaatgcgaaatacaggctag

DBGET integrated database retrieval system