KEGG   Chamaesiphon minutus: Cha6605_5537Help
Entry
Cha6605_5537      CDS       T02414                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cmp  Chamaesiphon minutus
Brite
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cha6605_5537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY96414
UniProt: K9UQB8
LinkDB All DBs
Position
5857613..5858206
Genome map
AA seq 197 aa AA seqDB search
MAFVQEALPYDVSALEPHMSAKTFEFHYGKHHATYVTNLNNLTKDTPMADMSIEDVVRGS
FGDASKAGIFNNAAQVWNHAFFWKSMKPNGGGAPTGELAAKIDADFGSFDQFKTDFKAAA
TTQFGSGWAWLVNDGGTLKITKTGNAENPLVHGQTPLLTLDVWEHAYYLDFQNRRPDFIS
TYLDSLVNWDFAAANFK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgtacaagaagctttgccttatgatgtcagtgctttagagccacacatgtcc
gcaaagacgtttgagtttcactatggtaagcaccatgctacttatgtgactaacctcaac
aatcttaccaaagatacgccgatggcggatatgtcgatcgaagatgttgttagaggtagt
tttggtgatgccagtaaagcaggtatcttcaataatgccgctcaggtttggaatcatgct
tttttctggaaatccatgaagcctaatggcggtggtgccccaactggcgaattggctgcc
aaaatcgatgctgacttcggtagcttcgaccaatttaaaacagactttaaagctgctgct
acgactcaatttggtagtggttgggcttggttagttaacgatggcggtacgctcaagatt
accaaaactggtaacgctgaaaatcccctcgttcacggccaaactcccctgctaacgtta
gacgtgtgggaacatgcctactacctcgatttccaaaatcgtcgcccagactttatcagt
acctacttagatagcttggtcaactgggattttgctgcggctaatttcaaatag

DBGET integrated database retrieval system