KEGG   Cyclobacterium marinum: Cycma_0185Help
Entry
Cycma_0185        CDS       T01592                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00240  Pyrimidine metabolism
cmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cycma_0185
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Cycma_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEL23968
UniProt: G0J1W2
LinkDB All DBs
Position
224564..225142
Genome map
AA seq 192 aa AA seqDB search
MFIEPSLGKTGKSGPKGQLEVICGSMFSGKTEELIRRLNRALIAKQRVEIFKPAIDKRYD
ENNVVSHNENIIRSTPVQFADDILLLAGNCDVVGIDEVQFFDAQIIPVVEQLANNGIRVI
VAGLDMDFEGKPFEPMPQLLAIAEYVTKVHAICMKCGDLASYSFRLSGDKSKVMLGEKES
YEARCRKCFYNL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgagccatcgctagggaaaaccgggaaatccggaccaaaaggacagctggaa
gtaatctgtggctcaatgttttccggtaaaactgaggaattgattagaaggctaaacagg
gccttaatagccaaacaaagagtggaaatattcaaacctgccattgacaaaaggtatgat
gaaaacaatgtagtttcacacaatgaaaacataatccgttctactcccgtccaattcgca
gatgacattttactacttgcaggaaattgtgatgtagtgggtattgacgaagttcagttt
tttgatgcgcaaataataccggtggtggaacaattggcaaataatggcattagggttatt
gttgccggcttagacatggattttgagggcaagccctttgaacctatgccacaattattg
gccatcgcagaatacgtaaccaaggtgcatgcgatttgcatgaaatgtggggaccttgca
tcttatagtttcagactttccggagataagtccaaagtaatgttgggtgaaaaagagagc
tatgaagcccgctgtcgaaagtgtttttataacctgtaa

DBGET integrated database retrieval system