KEGG   Cyclobacterium marinum: Cycma_0992Help
Entry
Cycma_0992        CDS       T01592                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00061  Fatty acid biosynthesis
cmr00620  Pyruvate metabolism
cmr00640  Propanoate metabolism
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01120  Microbial metabolism in diverse environments
cmr01130  Biosynthesis of antibiotics
cmr01200  Carbon metabolism
cmr01212  Fatty acid metabolism
Module
cmr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cycma_0992
   00640 Propanoate metabolism
    Cycma_0992
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Cycma_0992
Enzymes [BR:cmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Cycma_0992
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Cycma_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEL24764
UniProt: G0IUK1
LinkDB All DBs
Position
1165339..1166691
Genome map
AA seq 450 aa AA seqDB search
MFNKILIANRGEIALRIIRTCKEMGVKTVAVYSTADKDSLHVRFADEAVCIGAASSKDSY
LNIPRIIAAAEITNADAIHPGYGFLSENAEFSRICEEYNIKFIGASPEMINQMGDKATAK
ATMAAAGVPTIPGSEGLLNSIEEGLPLAEKIGYPVILKATAGGGGRGMRIVKDPAGFKKA
WDDARQESAAAFGNDGLYLEKFVEEPRHIEIQIIGDSTGKACHLSERDCSIQRRHQKLVE
ETPSPFITDDLRKRMGEAAIKGAEAIAYEGAGTIEFLVDKNRDFYFMEMNTRIQVEHPIT
EEVTDFDLIKEQIKVAAGEKISGKNYFPKLYAMECRINAEDSANGFRPSPGKIVNLHLPG
GKGVRIDSHVYAGYVIPPNYDSMIAKLIVSAQSREEVIVRMKRALEEFVIDGIKTTIPFH
LALLEDPQFNAGNFTTKFLDDFDFSKVQKS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaataaaatattaatagccaacagaggagaaattgctttaaggatcattcgtaca
tgcaaagaaatgggagtgaagactgtcgctgtctattccactgctgacaaggacagctta
catgtacgttttgctgatgaagcggtatgtataggtgccgcatcaagtaaagattcttac
ctaaatatccctagaatcatcgctgctgcagaaatcaccaatgcagatgccattcacccc
ggttatggtttcctttctgaaaatgcggaattttcgaggatatgtgaagaatacaacatt
aagtttattggagcaagtcctgaaatgatcaaccaaatgggtgacaaagcaacagccaaa
gccaccatggccgcggccggagttcctaccatccccggttctgaaggattgcttaactcc
atagaagaaggattgccattggcagaaaaaattggttaccctgtcatcctcaaagccact
gctggtggaggtggaagaggcatgcgtatagtgaaggatcctgcggggttcaaaaaagca
tgggacgatgccagacaagaatccgctgcagcatttggtaatgatggtttataccttgaa
aagttcgttgaagagcctcggcatattgaaatccaaatcattggagattcaaccggtaaa
gcttgccacttatctgaaagagattgctccattcagagacgtcatcaaaaattagttgaa
gaaacaccttctccttttatcactgatgacctgagaaaaagaatgggggaagccgcaatc
aaaggggcagaggcaatcgcctatgaaggtgccggaaccatagagtttttggtagacaaa
aaccgagacttctactttatggaaatgaacaccagaattcaagtagaacatccaataacg
gaagaagttacagattttgatttgatcaaagaacaaatcaaagttgctgctggagagaaa
ataagcgggaaaaattactttccaaaattatacgccatggagtgtcgaatcaatgcagaa
gattctgcaaatggattcagacctagtccagggaaaattgtcaaccttcacctccccgga
ggcaaaggcgtgagaattgacagccatgtttatgctggatacgttattccaccaaactat
gactctatgattgcaaaacttatcgtaagtgcccaatccagagaggaagttattgtacga
atgaaacgtgccttggaagaatttgtcattgatggcattaaaactaccatccctttccat
ttggccttattggaagatccgcaattcaatgccggtaattttaccactaaatttctggat
gattttgacttttcaaaagttcaaaaatcataa

DBGET integrated database retrieval system