KEGG   Cyclobacterium marinum: Cycma_1685Help
Entry
Cycma_1685        CDS       T01592                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00380  Tryptophan metabolism
cmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Cycma_1685
Enzymes [BR:cmr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Cycma_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEL25439
UniProt: G0IUP7
LinkDB All DBs
Position
1973836..1975116
Genome map
AA seq 426 aa AA seqDB search
MDQIAFELTPEFARKMDLADPLSTYREKFYIPEKNGQPLIYFCGNSLGLQPRSVNAYLKQ
ELEKWADKGVDGHFEGKVPWIDARKPSKRLIAPLVGANEQEVVAMNSLSVNLHLLMVSFY
QPKGKKFKILTEAGAFPSDQYILESQVKFHGLLPDEAILEMAPRPNEHLLRTEDILQKIE
DHKDELALIMLSGLQYYTGQLFDLEAISSAANKQGITIGFDLAHAIGNVPLRLHDWGVDF
ATWCSYKYLNSGPGNVSGIFVHEKHSDNALLPRFAGWWGHDEKERFKMKKGFKHMPGADG
WLLSNDNVLGLAAHQASLELFAEAGLDKLRKKSIQLTNYLEFAIHETIKDSELLEIITPL
KPTERGCQLSLLIHKKGKEVFDYWIDNGVVADWRNPNVIRLAPTPMYNTFQDVFEFSRIL
KNSLEA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggatcagattgcatttgaattaacaccggaatttgcgcgcaaaatggatcttgctgat
cccctctccacttaccgggaaaaattttatattccggaaaaaaatggacaaccactaatc
tatttttgtggcaactctctaggtttacagccccgatccgtcaatgcttatttgaaacaa
gaattagaaaaatgggccgacaaaggagtggacggtcacttcgaaggaaaagtaccctgg
atagatgctaggaaaccttctaaaaggcttattgcacctttggtaggggccaatgagcag
gaagtagtggccatgaatagcctcagtgtaaatcttcaccttctgatggtgtctttttac
caacccaaagggaaaaaattcaagatccttacagaagctggagcctttccttctgatcaa
tatattttagagtctcaggtaaaattccatggattattacctgatgaagccattttggaa
atggctccaagacccaatgaacacctgcttcgcacggaagacattcttcaaaaaatagaa
gaccataaggatgaattggccttaatcatgctttccggtcttcagtattataccggacag
ctttttgatttggaagccatcagtagcgccgccaataaacagggtatcaccataggattt
gaccttgcccatgccataggcaatgtccctctccgactgcatgactggggagtagacttt
gccacatggtgtagctacaaatacctcaactcaggacccggaaatgtatcaggaatcttc
gtgcatgaaaagcacagtgacaatgccctgctacccagatttgccggctggtggggacat
gatgagaaagaacgatttaaaatgaaaaaaggcttcaaacatatgcccggagctgatggc
tggttattaagcaacgacaatgtactgggtctggctgcccaccaagcctccctagaatta
tttgccgaagccggcttagataaattaagaaaaaagagcattcaattaaccaattatctc
gaatttgcaattcacgaaacaattaaagactccgaattgttagaaattataactccctta
aaaccaactgaaagggggtgccaactctctttattgatccacaaaaaaggcaaagaagta
tttgattattggattgataatggggtagtggctgattggagaaatccgaatgtcatcagg
cttgcacccacccctatgtacaatacctttcaggatgttttcgaattcagtagaattctt
aaaaactccttggaagcataa

DBGET integrated database retrieval system