KEGG   Cyclobacterium marinum: Cycma_2125Help
Entry
Cycma_2125        CDS       T01592                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmr  Cyclobacterium marinum
Brite
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cycma_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FliE
Motif
Other DBs
NCBI-ProteinID: AEL25870
UniProt: G0J2H9
LinkDB All DBs
Position
2471915..2472529
Genome map
AA seq 204 aa AA seqDB search
MTMKTLNYFLFIGAVSLAVACGPGANNSEESATDRLEITENQMDNMESETDTAEQTAMAV
LSGASGSEVSGTATFTQTAEGKVKLVLSVNNLSTGKHAVHLHENGDCSAEDASSAGGHWN
PADDEHGKRGENEFHAGDIDNLTVGEDGIGSLVMVVDGWSIGDGEDSDILNKAVIIHAEA
DDFTSQPSGAAGSRVACGVIQEST
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaagacacttaattattttctctttatcggggctgtatccctggcagttgcc
tgcggacccggagccaataattccgaggaaagtgctaccgatagactagaaattacagaa
aaccagatggacaatatggaaagtgaaaccgatactgccgagcagacagccatggctgta
ctctcaggagctagtggaagtgaggtttcagggacggctacctttacgcaaacagccgaa
ggaaaagttaaattggtgttgtcagtaaacaacttgtcaaccggaaagcatgctgttcac
ttgcatgagaatggagattgcagtgctgaagatgcatcttctgccggcgggcattggaac
cctgcggatgatgagcacggtaaaaggggtgaaaatgaatttcatgccggagatatagac
aatttgaccgttggagaagatggcataggatccttggtaatggtggtagacggatggtct
atcggtgacggggaagattcagatatcctaaacaaagcggtaattattcatgcagaggct
gatgactttacttcccaaccttccggagccgccggatcaagggtggcctgtggagtaata
caggaatccacctaa

DBGET integrated database retrieval system