KEGG   Cyclobacterium marinum: Cycma_2404Help
Entry
Cycma_2404        CDS       T01592                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00564  Glycerophospholipid metabolism
cmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cycma_2404
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Cycma_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Lycopene_cycl HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8 GIDA Pyr_redox Thi4
Motif
Other DBs
NCBI-ProteinID: AEL26146
UniProt: G0J6U8
LinkDB All DBs
Position
2809797..2811359
Genome map
AA seq 520 aa AA seqDB search
MYRENSLSRIKEEKGSWDLVIIGGGASGLGVALDALSRGLKVLLLEKSDFAKGTSSRSTK
LVHGGVRYLAQGEVGLVLEALKERGRLLKNAPHLTINQPFVIPLYTYFDRLKYGVGLKIY
DWMAGSLRLGKSKFVSKEETIKRLPQIKQKGLKGGILYHDGQFDDARLALAIAQTCIEMG
GCILNYARVNKLTKGEDGKINGLVFRDLIGKTNYRISAKSVVNATGVFADKILQMDNPDA
RKMIQPSQGIHLVMDSSFLGGVDALMIPETSDGRVLFAVPWEGKLVVGTTDTLVKKPKME
PKPLASEITFILETAKNYLVRPPKRSDVLSVFAGLRPLAAPKEGSTKTKEISRSHKVIVS
KSNLITITGGKWTTFRKMGEDTVDIHFKNHGLQKLESTSADQHLHGYSEERIKGHLQLYG
TDAALVLDLQKQRPELAERLHEGYPYTGAEVVWAVRKEMAFKIEDFLSRRCRILLLDAKA
SMQMAPKVAEIMAKELEKDEVWITEELEEFNKLAKKYLIK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtatagagaaaacagtttatcgagaatcaaagaggaaaaggggagttgggacctggta
attattggagggggagcctccgggttaggggtcgctttggatgctttgtccagaggatta
aaagtcttattgctagaaaaatcagattttgctaaagggacttccagcagaagtacaaaa
ttggtgcacggcggtgttcgctatttggctcagggagaagtggggttagtgttagaagcc
ttaaaagagcgtgggaggttattgaaaaatgcgccgcatctaaccattaatcagcccttt
gtaatcccactttacacctattttgaccgcctaaagtacggggtaggtcttaaaatttac
gactggatggcaggtagtttacgcttggggaaatccaagttcgtttctaaggaagagaca
ataaaaaggctgcctcaaatcaaacagaaaggcttaaaaggggggattttgtaccatgat
ggtcagttcgatgacgcaaggttagccttggccattgcacagacctgtattgaaatgggg
ggttgtattcttaattatgccagggttaataaattgaccaaaggtgaagatggtaaaatt
aatggtttggtctttagggatttaattggtaaaaccaattataggatttctgccaaatct
gttgtcaatgcaaccggggtgtttgctgacaaaatcctgcaaatggataaccctgatgcc
agaaaaatgatccaaccaagtcagggaatccacctggtcatggacagctcatttttgggt
ggagtggatgctttaatgattccggagacctctgatggaagggtattgtttgcagtgcct
tgggaagggaagttggttgtgggtactaccgataccttggtgaaaaagcctaagatggaa
ccaaaacctttggcttctgaaataacttttatattggaaacagccaaaaattatttggta
agaccaccaaaaagatcggatgtactttcagtttttgcaggcttgagaccacttgctgcc
ccaaaagagggaagcacaaaaaccaaagaaatttccagaagccataaagttattgtttca
aaaagcaatttaattaccattacaggtggcaagtggaccacctttaggaaaatgggtgaa
gacacggtagatatccattttaaaaatcatggtttacaaaaattagaaagcacatctgca
gaccagcatcttcacggctatagcgaagagagaattaagggtcatttacagttatatgga
acagatgccgcattggttttagatttgcaaaagcaaaggcctgaattggccgaacgattg
catgaaggttatccttataccggtgcggaagtggtgtgggctgttaggaaagaaatggct
ttcaaaatcgaggatttcctctcgcgacgttgtaggatattattactcgacgccaaagct
tccatgcaaatggcgcccaaagttgccgaaattatggcaaaagaacttgagaaagatgag
gtttggataactgaagagttggaagaatttaataaattagccaagaagtacttaataaaa
tag

DBGET integrated database retrieval system