KEGG   Cyclobacterium marinum: Cycma_2870Help
Entry
Cycma_2870        CDS       T01592                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00620  Pyruvate metabolism
cmr00680  Methane metabolism
cmr01100  Metabolic pathways
cmr01120  Microbial metabolism in diverse environments
cmr01200  Carbon metabolism
Module
cmr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cycma_2870
  09102 Energy metabolism
   00680 Methane metabolism
    Cycma_2870
Enzymes [BR:cmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cycma_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEL26608
UniProt: G0J2M5
LinkDB All DBs
Position
3343286..3345838
Genome map
AA seq 850 aa AA seqDB search
MANIYETEVAKRFTIYNSLFLDLPFDQIYRTGTLLPILSEACQNGFKKNKTPKEIIRQFF
EELMADKSEEERHDLLFKMVQYIERQVVLFDSIEDASFEKFNDIKGKGTMTALIARAEND
HKKDELIQKLKNFSVRLTLTAHPTQFYPGNVLAIITDLEQAIRKNDLGDVDLLLRQLGKT
AFINKEKPSPYEEAVSLTWFLEYVFYPSISDIMIRVLNQLNIPLHDWENPNLLKVGFWPG
GDRDGNPFVTHEITKKVADKLQNSILKCYYRDIRKVRRRLTFHNVESHLIKAEKGIYNTL
FGGDGDVFKSKDDLLAVLYDARKGIIEEHGGLSLELLDEFILKVRVFGFHFASMDVRQDS
RKHDALWDEILEKSEGEAALETYRQGDEEAKIEKILSIDKLPEISALEDPFHREMLESVK
SINYIQKNNGPMGCHRYIISNNQSVLHVLEVFQLNKLLLADGGDLSLDIVPLFETIDDLA
NAHGVMTKLYNNKVYREHLRKRGNKQSIMLGFSDGTKDGGYIRANWSILRAKEELTKVAR
EEGIDVIFFDGRGGPPARGGGNTHNFYASLGPNVENREIQITIQGQTISANYGKPVSCSY
NLEQLLSAGMESHLYPSSENSLTEKQKSLIDEMAEISYNAYKELKNHKQFVPYLEKVTPL
KFFGMTNIGSRPVKRSKGGSMKFEDLRAIPFVGAWAQMKQNIPGFFGVGKAIEELEKQGR
LGEVQQLYKDSLFFRSLLGNSMQSLAKSFYPATAYLKDDPQFGGFWDLMYSEYQRSYEKV
LAVAGMTDLLEDSPLSNQSIAIRERIVLPLITIQQYAIQTILDKGKEDTALQKLILRTMF
GIINAARNAA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatctacgagactgaagtcgcaaagcgttttacgatttataacagtctgttt
ttagacctgccttttgatcaaatttacaggacaggtaccttgctacctattttgtctgaa
gcttgtcaaaacgggtttaaaaaaaataaaacgccaaaggaaattatccgccaattcttt
gaagaattgatggctgataaatctgaagaagaaaggcacgaccttctctttaaaatggta
caatatatcgaacgacaagtagttctatttgattcgatagaagatgcttcctttgaaaaa
ttcaacgatatcaaaggcaaaggtaccatgaccgccttaattgcgagagcagaaaacgac
cataaaaaagatgaactgatacaaaagcttaaaaacttttccgttcgactaactttaact
gcacaccctacacagttttatcccggtaatgttctggccattatcacagacttggaacag
gccataaggaaaaatgatttgggagatgtagatcttctgcttcgccaattaggtaaaaca
gcatttatcaataaagagaaaccttctccttatgaagaagcagtaagccttacttggttt
ttggaatacgtgttctatccaagtatttcggacataatgattcgtgttctcaaccagcta
aatatccctcttcatgattgggaaaatcccaatttgctgaaagtaggcttttggccggga
ggtgacagggacggaaatccttttgtaacgcacgagatcactaaaaaagttgccgacaaa
cttcagaacagcatcctgaaatgttattatagagatatccgtaaagttagacgtcgcttg
accttccacaatgtggagagccacttgatcaaagcagaaaaaggaatctacaataccctt
tttggtggagatggagatgtttttaaatccaaagatgaccttcttgctgttttatatgat
gccaggaaaggcattatagaagaacatggcggcctatcacttgagttattggatgaattt
atccttaaagtaagggtgtttggatttcattttgccagcatggatgttaggcaagacagc
aggaaacacgatgccctttgggatgaaatattggagaaaagtgaaggagaagccgctttg
gaaacttaccgccaaggtgacgaggaagcgaaaattgagaaaatcctttccatagacaaa
ttacctgagatcagtgctcttgaggatcctttccacagagaaatgttggaaagcgtcaag
tctatcaattatatccagaaaaataacggcccaatgggctgtcacagatacatcatttcc
aacaaccaatcagtgctgcatgtgctggaagtttttcaacttaataaattgttgttggcg
gatggtggtgatctctcgcttgatattgttcctctatttgaaaccatcgacgatttggca
aatgcccatggggtgatgaccaagctttataacaataaagtatacagggagcaccttcgt
aagcgaggaaacaaacagtccattatgttgggtttttcagatggtaccaaagatggtgga
tatatccgagccaactggtccattttgcgggccaaagaggaacttacaaaagtggctaga
gaagaggggattgatgtcatcttctttgacggcagaggaggacctcctgcccgaggtggt
ggaaatacccataacttctacgcttctctcggtcccaatgtggaaaaccgtgagattcaa
atcaccattcagggacagaccattagtgccaactatggtaaaccggtaagctgttcttac
aatttggagcaactgcttagtgccggtatggaaagtcacttgtatccttccagtgaaaat
agcctgactgaaaaacaaaaatctcttatcgatgagatggcggaaatcagctataatgct
tataaagagctgaaaaatcacaagcagtttgttccttatctggaaaaagtaactcctttg
aaattcttcggtatgaccaatattggttccagaccggtgaaaaggagcaagggaggaagc
atgaagtttgaagaccttagggccataccatttgtaggtgcctgggcgcaaatgaaacaa
aatattccgggtttctttggggtaggtaaagccatagaggagcttgagaagcaaggtaga
ctgggagaggtacagcaactgtacaaagactccttgtttttccgatctttattgggaaat
tccatgcagtccttggccaaatcattttatccggctaccgcatacctcaaggacgatcct
cagtttggaggtttctgggacttgatgtacagcgagtaccaaaggtcttatgaaaaggta
cttgcagtagcaggaatgactgatttactggaggatagtccgctaagtaatcagtccata
gccatcagggaaagaatagtattaccgttgatcaccattcaacagtatgccattcagacc
attttggacaaagggaaggaagataccgctttacaaaagctgatccttaggaccatgttt
ggtattatcaatgccgcaaggaatgctgcataa

DBGET integrated database retrieval system