KEGG   Clavibacter sepedonicus: CMS0599Help
Entry
CMS0599           CDS       T00678                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cms  Clavibacter sepedonicus
Pathway
cms00020  Citrate cycle (TCA cycle)
cms00480  Glutathione metabolism
cms01100  Metabolic pathways
cms01110  Biosynthesis of secondary metabolites
cms01120  Microbial metabolism in diverse environments
cms01130  Biosynthesis of antibiotics
cms01200  Carbon metabolism
cms01210  2-Oxocarboxylic acid metabolism
cms01230  Biosynthesis of amino acids
Module
cms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cms_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMS0599
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CMS0599
Enzymes [BR:cms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CMS0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: CAQ00719
UniProt: B0RDS6
LinkDB All DBs
Position
complement(634099..635313)
Genome map
AA seq 404 aa AA seqDB search
MEKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDIDLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDDSIRDFARASLSYGLARNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEYAEQFAA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRAKLDGNDALKTFADTLED
VVITTVESGKMTKDLALLVGPDQPYQTTEEFLASLAENLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaaggtagaggggaccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagtccatcaaggacacgctcatccacccgtacctcgacatcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcacgatcgacgcg
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcacgatcttccgcgagcccatcatcatcagcaacatcccgcgcctc
gtgcccggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcacgcccaaggac
ggctccgagccgcagcagttcgaggtgttccagagccccggatccggcgtcgcgatgggc
atgtacaacctcgacgactcgatccgcgacttcgcgcgcgcctcgctgtcctacggcctc
gcccgcaactacccggtctacctctccaccaagaacacgatcctcaaggcctacgacggc
cgcttcaaggacctgttccaggaggtcttcgaggccgagtacgcggagcagttcgccgct
gcgggcctcacctacgagcaccgcctcatcgacgacatggtcgccgcctcgctcaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacaccgtc
gcgcagggcttcggctcgctcggcctcatgaccagcgtgctcaccacgcccgacggcaag
gtcgtcgaggcggaggccgcgcacgggaccgtcacgcgccactaccgccagcaccagcag
ggcaagcccacctcgacgaaccccatcgcgtcgatctacgcctggacccggggcctcgcg
caccgcgccaagctcgacggcaacgacgcgctgaagacgttcgcggacaccctcgaggac
gtcgtcatcacgacggtcgagagcggcaagatgacgaaggacctcgcgctcctcgtcggc
ccggatcagccgtaccagacgaccgaggagttcctcgcgtcgctggcggagaacctgcag
acgcgcctggcctga

DBGET integrated database retrieval system