KEGG   Clavibacter sepedonicus: CMS1939Help
Entry
CMS1939           CDS       T00678                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cms  Clavibacter sepedonicus
Pathway
cms00620  Pyruvate metabolism
cms00680  Methane metabolism
cms01100  Metabolic pathways
cms01120  Microbial metabolism in diverse environments
cms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMS1939 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CMS1939 (ppc)
Enzymes [BR:cms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CMS1939 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAQ02036
UniProt: B0REE4
LinkDB All DBs
Position
complement(2050685..2053417)
Genome map
AA seq 910 aa AA seqDB search
MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRESGGEDLLRDVERLRE
LVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLANLAEEHHRVRVLREREA
AAGFVPDSIPDAVGTLTEELGREEAMRRLGEMRFHPVLTAHPTEARRRAVATGIRRIGDL
LTERDGAMAGTLTGADIDRRLLEEIDGLWRTSPLRTTRPTPLDEVRTAMGVFDQTLFEVV
PRVYRLLDDWLLGEEAGVRDAVAPAFFRLGNWIAADRDGNPYVTAAVTEEAAGIASEHIL
LGLERVALRVGRSLTLGDADTPPSPELRELAAAQDALAPHLTARIGTRAPAELHRRVLLV
IAGRLAATRERHDDPIAYPSAAELLADLRVLQGSLRSAGAHRIAGGELQGLIWQAETFGF
HLAEMEVRQHSQVHREALREVLAVAAADASGDAVPELAPMTVEVLYVFRALARLQERHGV
APFCRFIVSFTQSADDIRTVHELAALALGSAEDAPVLDVIPLFETFADLNASTEILDGMI
RLPQVAARLEQTGRKLEVMLGYSDSSKDVGPVSATFALFDAQARIAAWARENDIELTLFH
GRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQGEVIFAHYGDKRIAARHIEQMAAATL
LASAPSNEERNAAAAQGSAEMVRTMDEASRARFFELVKAPGFAPWFTQVTPMEEIGLLAL
GSRPARRGLSVESLEDLRAIPWVFAWTQARINLTGWFGLGSALAAVGDEAVLRKAYDEWP
LFTSMIDNVEMSLAKTDGRLAERYLALGDRPDLAALVTEEMELTREWVRKATGRGDILEG
RPVLRRAVRLRSPYVDALSLLQLRALRALRTTASAATGQAAPGQADPTDPDHRLLLLTVN
GIAAGLQNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgacgactcccccgaagaagccgcttcccctcgagcacgactccacccgcgacggcacg
cgcgacgccgtcgagccggcgctccgctccgacgtcagccacctcggcggcctcctcggc
caggtgctccgcgagtccggcggcgaggatctgctgcgcgacgtcgagcgcctgcgcgag
ctggtcatcgacgcgtacgagagcgcgcgcgacgcctccatcgacgacgccgagcgcctc
gttgccacgttcacgcccgagcgcgccgagcaggtcgcccgggcgttcacctgctacttc
cacctcgcgaacctggccgaggagcaccaccgcgtccgtgtcctccgcgagcgcgaggcg
gcggcgggcttcgtgcccgactccatcccggacgcggtcggcacgctcaccgaggagctc
ggccgcgaggaggccatgcgccgcctcggcgagatgcggttccacccggtgctcacggcg
caccccaccgaggcgcgtcggcgggcggtggccacggggatccgccgcatcggcgacctg
ctcacggagcgcgacggggccatggccggcacgctcaccggtgcggacatcgaccgccgg
ctgctcgaggagatcgacggcctgtggcgcacctcgccgctgcgcaccacgcggcccacg
ccgctcgacgaggtccgcaccgcgatgggcgtcttcgaccagacgctgttcgaggtcgtg
ccgcgcgtctaccgcctgctcgacgactggctcctcggcgaggaggccggcgtccgcgac
gcggtcgcgcccgcgttcttccggctcggcaactggatcgcggcggatcgcgacggcaac
ccgtacgtcaccgccgcggtcaccgaggaggccgcgggcatcgccagcgagcacatcctg
ctcggcctcgagcgcgtcgccctccgcgtcggacgatccctcacgctcggcgacgccgac
accccgccgagcccggagctccgcgagctggccgccgcgcaggacgcgctcgcgccgcac
ctcaccgcccgcatcggcacccgcgcgcccgccgagctgcaccgccgcgtgctgctcgtg
atcgccggccgcctcgccgccacgcgcgagcgccacgacgaccccatcgcctacccgtcg
gccgccgagctgctcgccgacctccgcgtgctgcagggatcgctccggagcgcgggcgcg
caccgcatcgcgggcggcgagctgcagggcctcatctggcaggccgagaccttcggcttc
cacctcgccgagatggaggtgcgccagcactcgcaggtgcaccgcgaggcgctccgcgag
gtgctcgccgtggccgcggcggatgcgtcgggcgacgccgtccccgagctcgcgcccatg
acggtcgaggtgctctacgtgttccgcgccctcgcccgcctgcaggagcggcacggcgtc
gcgcccttctgccgcttcatcgtgtcgttcacgcagtcggccgacgacatccgcacggtg
cacgagctggccgcgctcgcgctcggctccgcggaggacgcgcccgtgctcgacgtcatc
ccgctgttcgagacgttcgccgatctcaacgcgagcaccgagatcctcgacggcatgatc
cggctgccccaggtcgcggcccgcctcgagcagacggggcggaagctcgaggtcatgctc
ggctactccgactcgtcgaaggacgtcgggcccgtgtccgcgaccttcgcgctgttcgac
gcgcaggcccgcatcgccgcgtgggcgcgcgagaacgacatcgagctcacgctcttccac
ggccgcggcggcgccctcgggcgtggtggcggcccggccgaccgcgccgtccgggcccag
ccgccgggatccgtcgacggccgcttcaagctcaccgagcagggcgaggtgatcttcgcc
cactacggcgacaagcgcatcgccgcccggcacatcgagcaaatggccgccgcgaccctg
ctcgcgtccgcgccctcgaacgaggagcgcaacgcggccgccgcgcagggatccgccgag
atggtgcgcacgatggacgaggcctcccgcgcccgcttcttcgagctcgtgaaggcgccc
ggcttcgcgccgtggttcacgcaggtcacgccgatggaggagatcgggctgctggcgctc
ggttcgcggcccgcccgccgcggcctgtcggtcgagtcgctcgaggacctgcgggccatc
ccgtgggtgttcgcgtggacgcaggcgcgcatcaacctcacgggctggttcggcctgggg
tcggcgctggccgccgtcggcgacgaggccgtgctgcgcaaggcctacgacgagtggccg
ctgttcacctcgatgatcgacaacgtcgagatgtcgctcgccaagaccgacggccgcctc
gcggagcgctacctcgcgctcggcgaccggccggatctcgcggcgctcgtcaccgaggag
atggagctcacgcgcgagtgggtgcgcaaggccaccgggcgcggcgacatcctcgagggc
cggccggtgctgcgccgggcggtgcgtctgcgcagcccgtacgtcgacgcgctgtcgctg
ctgcagctccgcgcgctccgtgcgctgcgcacgacggcctccgctgcgaccggccaggcc
gctcccggccaggccgacccgacggatccggaccaccggctcctgctgctcaccgtcaac
ggcatcgcggcggggctgcagaacacggggtga

DBGET integrated database retrieval system