KEGG   Cordyceps militaris: CCM_01103Help
Entry
CCM_01103         CDS       T03108                                 

Definition
(RefSeq) glutathione transferase, putative
Organism
cmt  Cordyceps militaris
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 DUF5053 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 18163136
NCBI-ProteinID: XP_006666324
UniProt: G3J366
LinkDB All DBs
Position
Unknown
AA seq 583 aa AA seqDB search
MASGSFASGQPQQTPHQPPQQHEQQQQQQYAMDMGIGYPSAAAAAAMGEVYRAQGNVFER
LEYQPQVEVNRQPQRRRRQQQDSASGGHAPVMQAASQAPMGAPDKQTQHMGQFGILAPTP
VPVVHPHRSMAPAMGQPTLHFAPAIQAGAGADADAAPSAHGKLGGKIVVDPPDLHAWREK
LFNVDEMIVLTQEQSTQKYKRKPFVSHYWDCRMKGRPPGTPKTEDPTKKRRRRSARERDL
CDVKIKITEYFPSTEPVQLDGGADGAATTSAAAVAAGYHGQRFWTIQRVNGNGGNGKGDG
VAGPHKHTLAKSDEIKKNSVQRHMASQDRETKRAQPAPRRPTGTAAVTARKHAREAGAAG
DVKLYAACHCPFSQRVWIALEAKGLPYQYCEADPHRKPAPAGLLEANPKGQVPAIRQGAW
ACAESSVILEYLEDLDARVPLLPSDARLKANCRFWINHINTDLLVAFYALLQNTDLARQA
DLITCLQAQLDRLAQAADERGPYFLGAALSLVDVHLAPWALRLRTILHPRRGWPAAAPAS
ASRWARWLDALERDAHVKATTSADDLYADTADMLINDPAPVPL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagggtcgttcgccagcggccagccacaacaaacacctcaccagccgccccaa
cagcatgagcagcagcagcagcagcagtacgccatggacatggggattgggtatccgtcg
gccgccgccgccgccgccatgggcgaggtgtaccgggcccagggtaacgtgtttgagagg
ctggagtaccagccgcaggtcgaggtaaaccgacagccgcagaggcgccgacgacagcag
caggacagcgccagtggaggtcatgcgccggtgatgcaggctgcatcgcaagcaccgatg
ggggcaccggacaagcagacgcagcacatgggccagtttggcatcttggcgccgacgcca
gtacccgtggtgcacccgcaccgatcgatggccccggctatgggccagccgacgctgcat
ttcgcgcccgccatccaggccggcgccggcgccgacgcagacgccgcgccctcggcccac
ggcaagctgggcggcaagattgttgtcgatccgccagacttgcacgcttggcgggagaag
ctattcaacgtggatgagatgattgtattgacacaggagcagtccacgcaaaagtacaag
cgcaagccgtttgtctcgcactactgggactgccgcatgaagggccgcccgcccggcacg
cccaagacggaggaccccaccaagaagcggcgccggcgcagcgcgcgcgagcgcgacctg
tgcgacgtcaagatcaaaatcaccgagtactttcccagcacggagccggtgcagctcgac
ggcggcgcggacggtgccgccaccaccagcgccgccgccgtggccgccgggtaccacggg
cagcgcttctggaccattcagcgcgtcaacggcaacggcggcaacggcaagggggacggc
gtcgctggcccgcacaagcacacgctcgccaagagcgacgagatcaaaaagaatagcgtc
cagcggcacatggcctcgcaggaccgcgagacaaagcgggcgcagccggccccgcgccgg
cctacaggcaccgccgccgtcaccgctcggaagcacgcgcgcgaggccggcgccgccggt
gacgtcaagctgtacgccgcgtgccactgccccttttcgcagcgcgtctggatcgccctc
gaggccaaaggcctcccgtaccagtactgcgaggcggacccgcaccgcaagcccgccccg
gcgggcctgctcgaggccaaccccaaaggccaggtgcccgcgatccggcaaggcgcgtgg
gcctgcgccgagtcgtctgtgattttggaatatctcgaggacttggacgcgcgcgtgccg
ctgctgccctcggacgcgcggctcaaggccaactgccgtttctggatcaaccatatcaac
acggacctcctcgtcgccttttacgcgcttctccagaatacggacctcgcgcggcaagca
gacctcatcacgtgcctgcaggcgcaactcgatcgcctcgcgcaggctgccgacgagcgt
ggcccgtactttctcggcgccgcactcagcctcgtcgacgtgcacctcgctccatgggcg
ctgcgcctgcgcaccattctgcacccccgccgcggctggccggccgcggcaccggcgtcc
gcctcgcgctgggcgcgctggctcgacgccctggagcgcgacgcgcacgtcaaggcgact
acgagcgccgatgacttgtacgcggatacggcagatatgctcatcaacgacccggcgccg
gtgccgctttga

DBGET integrated database retrieval system