KEGG   Cordyceps militaris: CCM_01290Help
Entry
CCM_01290         CDS       T03108                                 

Definition
(RefSeq) DNA ligase I, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmt  Cordyceps militaris
Pathway
cmt03030  DNA replication
cmt03410  Base excision repair
cmt03420  Nucleotide excision repair
cmt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CCM_01290
   03410 Base excision repair
    CCM_01290
   03420 Nucleotide excision repair
    CCM_01290
   03430 Mismatch repair
    CCM_01290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmt03032]
    CCM_01290
   03400 DNA repair and recombination proteins [BR:cmt03400]
    CCM_01290
Enzymes [BR:cmt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CCM_01290
    6.5.1.6  DNA ligase (ATP or NAD+)
     CCM_01290
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CCM_01290
DNA replication proteins [BR:cmt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CCM_01290
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CCM_01290
DNA repair and recombination proteins [BR:cmt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CCM_01290
   NER (nucleotide excision repair)
    Other NER factors
     CCM_01290
   MMR (mismatch excision repair)
    Other MMR factors
     CCM_01290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase NuDC
Motif
Other DBs
NCBI-GeneID: 18163321
NCBI-ProteinID: XP_006666509
UniProt: G3J461
LinkDB All DBs
Position
Unknown
AA seq 865 aa AA seqDB search
MSSPAKKRKLNNAAKNEKPPPKGLEYFFSKQKQNGGSSSAALGSCQTEKADAALTDEELA
RKLQAEWDKEATQVNLQEPADVGEPAVAELTRKDEPGDSTEPHPDVHEQPAPVAILGGKK
TLALQSAGMDEDVITITLPLDEPPLTFEPSKYVERLKEHWSKDGGNASYALLTRCFVLVS
GTASRIKIVDTLVNCLRLLIEGDPGSLLPAVWLATNSISPSYISMELGLGGSAISKALKQ
VCGLDGRSLKTLYDKYGDAGDVAFEAKKKQNFTLRKPKPLSIQGVYQSLVKVATTQGQGS
NEVKQRIVDRLLQDARGGEESRFIVRTLCQHLRIGAVKTTMLIALSRAFLLSKPANAEYE
TRNTPALAKLKKEELAEVWAKAEEVVKACFAKRPNYNDLIPNLLEIGVCEELLVRCGLAL
HIPLRPMLGSITRDLSEMLTKLQGRDFTCEYKYDGQRAQVHCDEEGKVSIFSRHLELMTD
KYPDLVELVPKIRGDGVSSFIMEGEVVAVDSASGELKNFQALTNRARKDVEIGSIIVQVC
LFSFDLMYLNGQSLLSRSLRERRELLRSLFTEVPNRFTWVKSLDASSTESETVLSFFKSA
TESKCEGIMVKILDNLPDVAYLGGEDGEAKEEEPKLQLPISKSKAKGNKKKDAESNEPPK
KRSRRKALLATYEPDKRLDSWLKVKKDYSSSFDTLDLIPIAGWHGQGRKAKWWSPILLAV
RNEESGTLEAVCKCISGFTDVFYKANKAFYDEGAETGEPKNTRLQMPSFIEYSGPMPDVW
FEPQEVWEMAFADITLSPTYTAAIGLVSDERGLSLRFPRFLKKRDDKSIDEASTNEFLAG
LWRKQEASASPAGKARPAGGDEEAE
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcccggcaaagaagaggaagctcaacaatgcggcgaaaaatgagaagccaccg
ccaaaagggctagagtacttcttctcgaagcagaaacagaacggagggagctcgtctgcg
gccctgggtagctgccaaacggaaaaggccgacgctgcgttaactgatgaagagctcgcc
cgcaagctacaggccgaatgggacaaggaggcgactcaagtgaatctccaagaaccagct
gatgtcggagagccggcagtagccgaattgactcgaaaggatgagccgggagactcaacg
gaaccacaccccgatgtacacgagcagccagctcctgtggccattcttggcgggaaaaag
actctcgcgcttcaatctgcgggcatggacgaagatgttatcacgataaccctgccgctg
gatgaaccgccgctgacattcgagccatccaaatacgttgaacggctcaaggagcattgg
tctaaagatggaggcaatgcctcgtacgctctgcttactagatgctttgtgcttgtcagt
gggacagcgagccgcatcaagattgtggacacattggtcaattgcttgcggttactgatc
gaaggtgacccggggagtctcctaccggcggtttggctggcgacaaattcaatctcacca
tcgtatatatcaatggagttaggcctaggagggtcagccatttccaaggcactgaagcaa
gtctgcggcctggacggccgatccctcaagaccttgtacgacaagtacggcgatgcaggt
gatgtggcctttgaggcgaagaagaagcaaaacttcacgctcagaaagcctaagccgttg
tctatccaaggggtgtatcagtctcttgtcaaagtggcgactacgcaaggccaaggtagc
aacgaggtcaagcagcgcatcgtcgatcggcttttgcaggatgctcgtggcggcgaagag
agtcggttcatagtgcgaacgctgtgtcagcatcttcgaatcggcgcagtcaagacgaca
atgctcattgccctttccagagcatttctgctttccaagccagcgaatgccgagtatgag
acgcgcaacacacccgcactcgcaaagctgaagaaggaagaactcgccgaagtatgggca
aaggcggaggaggtcgtcaaggcctgttttgcgaagcgtccaaattacaacgacctgatc
cccaacctcttggagattggcgtctgcgaagagcttctcgtccgatgcggcctggcgctt
cacatcccacttcgacccatgctcggaagcatcactcgagacttgtcggaaatgctcacg
aagctgcaaggccgcgacttcacatgcgaatacaaatatgatggccaacgcgcacaggta
cattgtgacgaagagggtaaagtctccattttctcccggcatctggaattgatgacggac
aagtacccagacttggtagaactggtgccaaagatacggggagacggcgtttcgagtttc
atcatggaaggtgaggtcgtggctgtggatagtgccagtggcgaactgaagaacttccag
gctctcacgaacagagcccgaaaggatgttgagattgggagcatcattgttcaagtatgc
ctattctcatttgatctgatgtacttgaacggacagtcgctgctcagtcggtcgttgcga
gagaggcgagaactgctgagatctctcttcaccgaggtgcccaatcgctttacttgggtc
aagagcctggatgcttcttcgaccgagtcagagaccgtgttgagctttttcaagtcggca
acagaaagtaaatgcgagggcatcatggtgaagattttggataaccttccagatgtcgcc
tatcttggaggggaagatggtgaggctaaagaggaggagcccaaattgcaactcccgata
tcaaagtctaaggcaaaagggaacaagaaaaaagacgcagagtcgaatgagccacccaag
aaaaggtcaaggcgaaaagcattgctggctacgtatgagccagacaagcggctggattct
tggctcaaggtcaagaaggattatagctcgagcttcgacacactggacctgatacctata
gcgggatggcacggccagggccgcaaagccaagtggtggtcgccgattttactggctgtg
cgaaacgaagagtcggggacgctggaggctgtctgcaagtgcatctctggatttaccgac
gtgttttacaaagccaacaaggcattctacgacgagggtgcagagaccggcgagcccaag
aatacccgtctgcagatgcccagctttatcgaatactccggcccgatgcccgatgtctgg
ttcgagccgcaggaagtgtgggagatggcgtttgccgacattacgctgagtcccacatac
acggcggcgattgggcttgtgagtgacgagagagggctgagtctccgatttccacgattc
ttgaagaagcgagacgataaaagcatagacgaagcgagcacgaacgagtttctcgcaggc
ctgtggcggaaacaagaagcatcggccagtccggcgggcaaggccaggcctgcgggagga
gacgaagaggcggaatag

DBGET integrated database retrieval system