KEGG   Cordyceps militaris: CCM_01778Help
Entry
CCM_01778         CDS       T03108                                 

Definition
(RefSeq) cAMP-dependent protein kinase type 3
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cmt  Cordyceps militaris
Pathway
cmt04113  Meiosis - yeast
cmt04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CCM_01778
  09143 Cell growth and death
   04113 Meiosis - yeast
    CCM_01778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmt01001]
    CCM_01778
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cmt03019]
    CCM_01778
   03036 Chromosome and associated proteins [BR:cmt03036]
    CCM_01778
Enzymes [BR:cmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CCM_01778
Protein kinases [BR:cmt01001]
 Serine/threonine kinases: AGC group
  PKA family
   CCM_01778
Messenger RNA biogenesis [BR:cmt03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CCM_01778
Chromosome and associated proteins [BR:cmt03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CCM_01778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 18163808
NCBI-ProteinID: XP_006666996
UniProt: G3J7F3
LinkDB All DBs
Position
Unknown
AA seq 682 aa AA seqDB search
MGRRKASSGKLLAVVAWPEAGQAKSSATLGELPKVPRYKVHAVCVGSSGPVRPKANSPSP
PLPPNNQTAHSRSHHMPGLGFLKKKRTREGISDPSSSNPTSPVAPTNSKPFDSSRQPAGA
AAITAAAASASASQAGPPSHGAAHAANPNPPSTTATSQQQAQAASEAPQQPQPQNQFLMN
PAYGGAGTLQHQNLPTISNLMNTQQPDPAAANNNNGYPNSHYPANLIPQNLHAASESPGT
DPERLRQQQQQAHPIPPAAAAAMQPQQQQHHQVPLYQQAQQMQQQHQGHHHQQVSISQPR
TTKGKYTLTDFDILRTLGTGSFGRVHLVQSKHNQRFYAIKVLKKAQVVKMKQVEHTNDER
RMLSDVKHPFLITLWGTFQDWKNLYMVMDFVEGGELFSLLRKSGRFPNPVAKFYAAEATL
AIEYLHSKNIIYRDLKPENLLLDRHGHLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSN
KGYNKWSLGILIYEMLCGYTPFWDSGSPMRIYENILKGKVKYPAYVNADAQNLLERLITA
DLTKRLGNLYGGPTDVKNHPWFSEVTWDRLARKDIDAPYTPPVKAGTGDASQFDRYAEDP
DGYGHAGGADEYVTAQKNMSMQLLTTMLVTGTYLPSFKSTGESRRLLGTWTSYSRLEREL
SAYPSTAGQSAQRLRVGPCYKT
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtcgcaaggcctcatccggaaagctacttgcggtggttgcttggcccgaggcg
ggccaagctaaaagcagtgcaaccttgggtgagctgccaaaggtcccaaggtacaaggta
catgccgtctgcgtgggctctagcggcccggtcaggcccaaggccaattcaccctccccg
cctcttccccccaacaaccaaaccgcgcactcgcgctctcaccacatgcctggcctgggc
tttctcaagaagaagaggacgagagagggtatctctgatccgtcatcgtcaaaccccacc
agcccggtcgcgcctacaaactcgaagccttttgactcgtcccgccagccagccggcgct
gccgcgatcaccgccgccgccgcctccgcttccgcgtctcaggcaggtccgcccagccac
ggcgccgcccacgccgcgaacccgaacccgccctcgacgaccgcaacttcccagcagcag
gcgcaagctgctagcgaggctccccagcaaccgcaaccgcaaaaccagttcctgatgaat
cccgcatacggaggggcagggaccctccaacaccaaaacctcccgaccatcagcaaccta
atgaacacgcagcagcccgaccctgctgctgccaacaacaacaacggataccccaattct
cactatcccgccaacctcatccctcagaacctccatgccgccagcgagagccctggcacc
gaccccgagcgacttcgacaacagcaacagcaggctcatcctatcccacccgccgccgcc
gccgccatgcagccccagcagcagcagcatcaccaggtgcccctctaccagcaggcccag
cagatgcagcagcagcaccaaggccatcaccaccagcaggtctccatatcccagcctcgc
acgacaaagggcaaatacacattgacagactttgatatcctcagaaccctcggtaccggt
agtttcggtcgagtgcatctagtccagtccaagcataaccaacgtttctacgccatcaag
gttttgaagaaggcacaagtcgtcaagatgaagcaggtcgagcacaccaacgacgagcgc
cgcatgctcagcgatgtcaagcatccttttctcatcaccctctggggtactttccaggac
tggaagaacctttacatggtcatggactttgttgaaggcggcgagctcttttcgctgttg
agaaagtccgggcgtttccccaaccccgttgccaagttttatgcggccgaggccacgctg
gctatcgagtacctgcactccaaaaacatcatctacagagacttgaagccggaaaacctg
ttactcgatcgtcatgggcatctcaagattaccgactttggtttcgccaagcgtgttccg
gacaagacctggacactgtgcggcactccggattatctggcgccagaggttgtctccaac
aagggttacaacaagtggtcccttggcattctcatctacgaaatgctctgtggctacaca
ccgttctgggatagtggctcgccaatgagaatatacgagaacatcctcaagggcaaagtc
aaatatcccgcatacgttaacgccgacgcgcaaaacctgctggagcgactgatcacggca
gatttgacaaagagacttggcaatctttacggtggccccaccgacgtgaagaaccacccg
tggttctctgaagtcacctgggatcgactcgctagaaaggatatcgatgcgccgtataca
ccacccgtcaaggctggtacgggcgacgcgagccagtttgatagatatgcagaggatccg
gatggctatggccatgctggcggagctgatgagtatgtgactgctcaaaaaaatatgtcc
atgcagctgctaacaaccatgctagttacgggcacctatttaccgagttttaagtcgact
ggtgaaagtcgacgactgctggggacgtggaccagctattcgagactggaacgtgagctt
agtgcctacccgtcgactgcagggcagtcggcacaacgcttgcgtgttggaccatgttac
aagacatga

DBGET integrated database retrieval system