KEGG   Cordyceps militaris: CCM_02366Help
Entry
CCM_02366         CDS       T03108                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cmt  Cordyceps militaris
Pathway
cmt00020  Citrate cycle (TCA cycle)
cmt00190  Oxidative phosphorylation
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
cmt01130  Biosynthesis of antibiotics
cmt01200  Carbon metabolism
Module
cmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cmt_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCM_02366
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCM_02366
Enzymes [BR:cmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCM_02366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 18164393
NCBI-ProteinID: XP_006667581
UniProt: G3J9B6
LinkDB All DBs
Position
Unknown
AA seq 760 aa AA seqDB search
MYGHRNLEINAKIRNDESCDADLGELQYIVATTDMREMASYSASSSTRPGMVGHSSVHRL
PLSCSDWPKTSRLAVFSPNYSIILPRHQTAGFLNPTTTYLHVQSASPVDTSPLSRLHPRP
FLRLASRPAAFSQAQARAFSTTRPAARVIANGPLRAKEASPFVSNKYPVIDHEYDAIVVG
AGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVK
GSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTDEGKIYQRAFGGQSQKFGKGGQAYR
CCAAADRTGHALLHTLYGQSLAHNTNYFIEYFALDLIMQDGECRGVLAYNQEDGTLHRFL
ANNTVLATGGYGRAYFSCTSAHTCTGDGMAMAARAGLPNQDLEFVQFHPTGIYGAGCLIT
EGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGAEKDHIYLQL
SHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGEVITVDAQG
QDQVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGAKLKPLAAD
AGAEHIEVLDQVRNADGHRTTAEIRLAMQKAMQTEVSVFRTQESLDEGVRKMNEIDATYK
DVGIKDRSMIWNSDLVETLELRNLLTCAIQTATSAAARKESRGAHAREDYPDRDDKEWMK
HTLSFQKTPHGKVDLSYRRVISTTLDEAECKPVPPFKRVY
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggcataggaatttggaaataaatgccaaaatacgcaatgatgaatcatgcgac
gcagatttaggagagcttcagtacattgtggcaacgacggacatgcgcgagatggcttct
tattcggcttcttcatcaaccaggccgggaatggtcggccactctagtgtccaccgctta
ccattatcttgttctgattggccaaagacgtcccgactcgcggttttctcaccaaattac
tccataattcttccccgtcaccaaacggctggcttcctgaacccgaccaccacctaccta
cacgtgcaatccgcatcgcccgtcgacacatctcccctctcccgtctacatcctcgtccc
ttcctccgattggcctcccggcctgcagcgttctcgcaggcgcaagctagagccttttct
accacacgcccggctgctcgcgtcattgccaacggacctctgcgcgccaaggaagcttct
cctttcgttagcaacaagtaccccgtcatcgaccacgagtacgatgccatcgttgttgga
gctggcggcgccggtctccgtgccgcctttggtcttgccgaggctggtttcaacactgcc
tgcatctccaagctgttccctacgcgttcgcacaccgtcgccgctcagggtggtattaat
gccgcccttggcaacatgcacgaggatgactggagatggcacatgtacgacaccgtcaag
ggctcggactggctcggtgatcaggacgccatccactacatgacccgtgaggctcccgcc
tccatcatcgagcttgagcactacggctgccccttctcccgtaccgacgagggcaaaatc
taccagcgtgcgttcggtggtcagtcgcaaaagttcggcaagggtggccaggcctaccga
tgctgcgccgctgctgatcgtaccggtcacgcccttctccacaccctctacggccagtcc
ctcgctcacaacaccaactacttcatcgaatactttgctctcgacctgatcatgcaggat
ggcgaatgtcgcggtgttctcgcctacaaccaggaggacggaaccctccaccgattcctt
gccaacaacactgtccttgccacgggcggatacggacgtgcctacttcagctgcacgtca
gcccacacttgcactggtgatggtatggctatggctgctcgcgctggtcttcccaaccag
gatctcgagttcgttcagttccaccctactggtatttacggtgctggctgcctcatcacc
gagggtgctcgtggtgagggtggttacctcctcaactccgagggtgagcgtttcatggag
cgctacgcccctaccgccaaggatcttgcctctcgtgacgtcgtctctcgttccatgacc
atggaaatccgtgacggccgtggtgtcggtgctgagaaggaccacatctacctccagctc
agccatctgcccgctgaaattctcgctgagcgtctgcccggtatctctgagactgccggt
atctttgctggtgtcgatgtccgcaagcagcccattcccgttcttcctaccgtccactac
aacatgggtggtatccccacccgctacactggtgaggtcattactgttgacgcccagggc
caggaccaggttgtccccggtctgttcgcttgcggtgaagccgcttccgtttctgtccac
ggtgccaaccgtctcggcgccaactctcttctcgatctcgtcgtttttggccgtgccgtt
tcgcacacgatccgtgacaacttcacgccgggtgccaagctcaagccccttgctgccgat
gctggtgctgaacacattgaggttcttgaccaggtccgcaatgctgatggccacaggact
actgctgagattcgtcttgctatgcagaaggctatgcagactgaggtttccgtcttccgt
actcaggagtccctggatgagggtgtgcgcaagatgaacgagattgacgccacctacaag
gacgttggtatcaaggaccgcagcatgatctggaactcggatctcgtggagaccctggag
ctccgtaacttgcttacttgcgctatccaaaccgccacttctgccgccgcccgcaaggag
tcccgtggtgcccacgcccgcgaggactaccccgatcgcgatgacaaggaatggatgaag
cacacgctgtccttccaaaagacgccccacggcaaggtcgacctgagctaccgtcgcgtc
atctccacgacgctggacgaggccgagtgcaagcccgttcctcccttcaagcgtgtatac
taa

DBGET integrated database retrieval system