KEGG   Cordyceps militaris: CCM_02411Help
Entry
CCM_02411         CDS       T03108                                 

Definition
(RefSeq) glutathione S-transferase family protein, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmt  Cordyceps militaris
Pathway
cmt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCM_02411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmt02000]
    CCM_02411
Enzymes [BR:cmt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCM_02411
Transporters [BR:cmt02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCM_02411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 18164438
NCBI-ProteinID: XP_006667626
UniProt: G3J9L4
LinkDB All DBs
Position
Unknown
AA seq 274 aa AA seqDB search
MGEPDVKRLKTDDEPEYELIYWPGLPGRGEFVRLLFEEAGVPYTDHAQVPDQAVAQVLAL
TDAKNTGDASNPPIFAVPALRHGAVLLNQTPNILLYLAPKLGLSPPPTETAFYHLHQASL
TILDGFCNEVHETHHPIAVSLFYEDQKAEAKRRSKAFIEERAPKYLAYVQRLLDAKTSGE
GPWIHGNSLTYVDLVLFQETKCIDGTLFAFPKTMAQLKSSGKYDGVFALYDAVKERPKIK
AYLASERHQKYADGIWRHYPELEATMEAEVTVKE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagcccgatgtcaagcgcctcaagaccgacgatgagcccgagtatgaattgatc
tactggcccggcctccccggccgcggcgagttcgtgcggctgctgtttgaagaggccggc
gtgccgtacacggaccacgcccaggtgccggaccaagccgtcgcccaggtcctcgccctc
accgacgccaagaacaccggcgacgccagcaacccgcccatctttgcggtgccggccctc
cggcacggcgccgtcctgctcaaccagacacccaacatcctcctctacctcgcgcccaag
ctcgggctgtcgccgccgccgaccgagacggccttttaccacctgcaccaggccagcctc
accatcctcgacggcttctgcaacgaggtccacgagacgcaccaccccatcgccgtctcg
ctcttctacgaggaccaaaaggcggaggccaagcggcgctccaaggcctttatcgaggag
cgcgcgcccaagtacctcgcctacgtgcagcggctgctcgacgccaagacgagcggcgag
gggccgtggatccacggcaacagcctgacctatgtcgaccttgttctcttccaggaaaca
aagtgcatcgacggcacgttgttcgcattccccaagacgatggcgcagctcaagagctca
ggcaagtatgatggcgtctttgcgctctacgatgccgtcaaggagcggccaaagatcaaa
gcctacttggcgagcgagcgacatcaaaagtatgccgacggcatctggcgccactatccg
gaactagaagcgacgatggaggctgaggtgacagtgaaggagtag

DBGET integrated database retrieval system