KEGG   Cordyceps militaris: CCM_03992Help
Entry
CCM_03992         CDS       T03108                                 

Definition
(RefSeq) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmt  Cordyceps militaris
Pathway
cmt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCM_03992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmt02000]
    CCM_03992
Enzymes [BR:cmt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCM_03992
Transporters [BR:cmt02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCM_03992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 18166015
NCBI-ProteinID: XP_006669203
UniProt: G3JDE4
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MATVDTSLPPEPSGAAAGLAAQHADAHPLKLYGGWFCPFVQRSWIVLEEKKIPYQYIEIN
PYKKAESFLAMNPRGLVPTLAVPAGPQESARKPLFESNIISEYLDEEYGDESKHGPHLMP
KDAYEKARARLWIDHISNKIIPAFYKLLQHTDEKPFTLDEARKELHKHILALTDQMDSEG
PFFAGKELTMVDVCLAPWAKRFWLIDHYKSGGVGIPSQGQSQEWGRWREWFKAISERKSV
KDTWSADERYLVAYKRYADDTTNSEVGQATRQGKKLP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccacggttgacacttctcttcccccagagccctctggagctgctgcaggcttggct
gctcagcacgctgacgcccacccgctgaagctctacggcggttggttttgtccctttgtt
cagcgctcctggatcgttcttgaggagaaaaagatcccctatcaatacattgagatcaac
ccgtacaaaaaggctgaatcatttttggccatgaacccccgaggccttgtgccaacactt
gccgtgccagctggtccgcaagagtcagcgcggaagcctctgtttgaaagcaacattatc
agcgagtacttggatgaggaatacggcgatgaatcaaaacatggaccccatttgatgccc
aaggacgcctacgagaaagcacgcgctcgcctctggatcgaccatatcagcaacaaaatc
atccctgcattctacaagttgctgcagcacaccgacgagaagccattcacgttagatgag
gccaggaaagagcttcataaacatatcctcgcactcacagatcagatggactcggaaggt
ccgttttttgcaggcaaagagctgaccatggtggatgtctgcttggcaccatgggctaaa
cgcttctggctcattgatcactacaaaagtggcggtgtagggattccttctcaaggtcaa
agtcaggaatggggaagatggagagaatggttcaaggcgatttcggagcgcaagagtgta
aaggacacctggagcgctgatgagcgctaccttgtcgcatacaagaggtatgccgatgac
actaccaactcagaggtcgggcaagcgacgcgtcaggggaaaaaacttccttaa

DBGET integrated database retrieval system