KEGG   Cordyceps militaris: CCM_06280Help
Entry
CCM_06280         CDS       T03108                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cmt  Cordyceps militaris
Pathway
cmt00010  Glycolysis / Gluconeogenesis
cmt00051  Fructose and mannose metabolism
cmt00052  Galactose metabolism
cmt00500  Starch and sucrose metabolism
cmt00520  Amino sugar and nucleotide sugar metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
cmt01130  Biosynthesis of antibiotics
cmt01200  Carbon metabolism
Module
cmt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cmt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCM_06280
   00051 Fructose and mannose metabolism
    CCM_06280
   00052 Galactose metabolism
    CCM_06280
   00500 Starch and sucrose metabolism
    CCM_06280
   00520 Amino sugar and nucleotide sugar metabolism
    CCM_06280
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CCM_06280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmt04131]
    CCM_06280
Enzymes [BR:cmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CCM_06280
Membrane trafficking [BR:cmt04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CCM_06280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18168295
NCBI-ProteinID: XP_006671484
UniProt: G3JJT6
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MVGLGPRAPPSRKADVPKDTMEAIRNIEELFTVDTAKLKAITEHFVSELTKGLTKEGGSI
PMNPTWVMSYPDGNETGTFLALDMGGTNLRVCQITLTDKRSEFDIIQSKYKMPEELKTGK
SDELWEYIADCLHQFLETHHGDTKNIGTLPLGFTFSYPATQNYIDAGILQRWTKGFDIDG
VEGQDVVPMFEAALAKRGVPIQLTALINDTTGTLMASAYTDPTMKIGCIFGTGCNAAYVE
HCGSIPKLADMGLPDDMEMAINCEWGAFDNEHKILPRTKYDVIIDEESPRPGQQAFEKMI
AGLYLGEIFRLALVDLHNEKHLFQGQDINCLRKAYSLDASFLSAIEEDPFENLQETFDLF
ANKLQINVTGPELELIRRLAELIGTRAARLASCGVAAICKKKNFKTCHVGADGSVFNKYP
HFKARGAQALKEILDWPDKTDAKAEDPVEILAAEDGSGVGAALIAALTLKRAQQGNLAGI
LHPERFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggttggcctaggtcctcgcgctccgccctctagaaaagccgatgttcccaaggacacc
atggaggcgatccggaacattgaggagctctttacggtcgacactgccaagctcaaggcc
atcacagagcacttcgtctccgagcttaccaagggcctcaccaaagagggtggcagcatt
cccatgaaccctacttgggtcatgtcgtatcccgatggcaatgagactggcaccttcctc
gccctcgacatgggcggcaccaacctgcgcgtctgccaaatcacccttacagataagagg
tccgagtttgacattatccagtccaagtacaagatgcctgaagagctcaagactggcaag
agcgatgagctgtgggagtacattgccgactgtctccaccagttcctcgaaacccaccat
ggtgacaccaagaacattggcaccttgcccttggggttcaccttttcttaccccgctacc
cagaactacattgacgcgggtatcttgcagcgatggaccaagggctttgacattgacggc
gtcgagggccaggatgtcgttcccatgttcgaggctgctcttgccaagcgtggtgttccc
attcaactgactgctcttattaatgacaccaccggaacgctcatggcctcggcctatact
gaccctaccatgaagattggctgcatcttcggcaccggctgcaacgccgcgtacgtcgaa
cactgcggttcgatccccaagcttgccgacatgggtctacctgatgacatggaaatggcc
atcaactgcgagtggggtgcctttgacaatgagcacaagattctaccccgtaccaagtac
gatgtcatcattgatgaggagtcaccccgccctggccaacaggcgtttgagaaaatgatt
gcaggtctctaccttggcgagattttccgccttgcccttgtcgatctgcataacgaaaag
cacctctttcagggacaggacatcaactgtctgcgcaaggcctacagcctcgacgcttcg
ttcctttcggctattgaggaggatcctttcgagaacttacaggagacgttcgacctgttt
gcaaacaagttgcaaatcaatgtcaccggccccgagcttgagctgatccgccgcctcgct
gagctgatcggtacccgcgccgcccgtctcgcttcctgcggtgtcgctgccatttgcaag
aagaagaacttcaagacctgccacgtcggtgccgacggctccgtcttcaataagtaccct
cacttcaaggctcgtggagcgcaggccctgaaggagattcttgactggcccgacaagact
gatgccaaagccgaggacccggttgaaattcttgccgccgaagacggcagtggtgtcggt
gccgctctgattgccgccttgaccctgaagcgtgcgcagcagggcaacctggcgggcatt
cttcacccggagcgcttcaaatag

DBGET integrated database retrieval system