KEGG   Cordyceps militaris: CCM_06645Help
Entry
CCM_06645         CDS       T03108                                 

Definition
(RefSeq) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
cmt  Cordyceps militaris
Pathway
cmt00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCM_06645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmt01007]
    CCM_06645
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmt03016]
    CCM_06645
Enzymes [BR:cmt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     CCM_06645
Amino acid related enzymes [BR:cmt01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CCM_06645
Transfer RNA biogenesis [BR:cmt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CCM_06645
 Prokaryotic type
    CCM_06645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon
Motif
Other DBs
NCBI-GeneID: 18168659
NCBI-ProteinID: XP_006671849
UniProt: G3JN44
LinkDB All DBs
Position
Unknown
AA seq 579 aa AA seqDB search
MCPLTRAVCGRGPVRAGSTAQYLTGRRIVRRCRSTLSKIWVPTGGIAETESESGHDKLIR
AGFLRQSQAGIFQLLPLGLRVQNKIEKLIDKHMESIGASRLSLSTITSEELWKKSDRLDS
VAPELFRLKDRKEVSLMLSPTHEEEITTLVANAVQSYKDLPLRLYQITRKYRDEMRPRQG
LLRSREFLMKDLYTFDLSSEAAIETYQQVQAAYKAIFDEMKVQILVAEASSGDMGGNHSH
EYHLADSTGEDTVAHCNSCEYTANDEVAISKINPQHALDTNAPSSYGLWRGITKDRNTLI
NAWYPQSDGGNLNVHAVKTLVPELDTSVHDPLPLWEVAVDNPETALVNIVDSRLAPGFGK
IHSKLALLPEELQDDFIGPQFATSTATNGDGLNLLALAEGDGCPRCESGTLKISRALELG
HTFYLGTRYSKPLEALVSLPEKPSQPIPIQMGCFGIGVSRIFGAVAENRADSRGLNWPRA
IAPFEVAVIPSSAVNDEMLAFFDSLVDGGSFDAVLDDRKKAFGWKMKDADITGYPVVVVL
GKAWRERGVCEVQCRSLELKQEVAASELPMVLEQLLQKL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccctgacacgggcggtatgtggccgtggccctgttcgtgcaggttccacggca
caatacctcacaggccgccgcatcgttcgccgatgccggtctactctctcaaaaatatgg
gtgcctacaggaggaattgccgaaacggaaagtgaatccggacatgacaagctcatccgt
gctggattccttcgacagtctcaagcaggaatcttccaacttcttccgttgggtcttcgt
gtgcagaacaaaattgagaaattgattgacaagcacatggagtcaattggggcatcgcgg
ctttcgttgtccaccataacttctgaagaactctggaagaaaagtgatcgcctggacagt
gttgcgccagagctctttcgcctgaaagaccgtaaagaggtttcgctcatgctttctccg
acgcatgaagaagagataacaacattggtcgcaaatgcagtgcaatcatataaagacttg
cctttacgactgtaccagatcaccagaaagtatcgcgatgagatgaggccgaggcagggc
ttgcttcgttctcgtgaatttctgatgaaggatttgtacacctttgatttatcctcagag
gctgcgattgaaacatatcaacaagttcaagccgcgtacaaggcgatttttgatgagatg
aaggtacaaattctcgttgccgaggccagctctggcgatatgggcgggaatcacagccac
gaataccatctcgcggattcaactggggaagacactgttgcacattgcaatagctgtgaa
tatactgcaaatgatgaagtcgcaatctctaaaatcaacccgcaacatgccctcgacacc
aacgcgccatccagctacgggctatggagaggaattaccaaggatcggaatacgctgatc
aacgcgtggtacccccaaagtgacggcggcaatctcaatgttcatgccgttaaaaccctg
gttccggagctggacacaagcgtgcatgaccctctaccgctttgggaggtcgcagttgac
aaccctgaaactgcgctggtgaatattgttgatagtcggcttgcacctggcttcggaaaa
attcattccaagctggctcttctccccgaagaattgcaagatgacttcattggccctcaa
ttcgcaacgagtactgctacaaatggcgacggattgaatttacttgccttggctgaagga
gatggatgcccgcgatgcgaatcagggacactcaaaattagccgagctctagagcttgga
cacacgttttatctaggcacgcggtattccaagcccctcgaagccctcgtgtcgcttcct
gagaaaccgtcacaaccgattcccattcagatgggttgctttggtattggcgtgtcacgc
atttttggcgccgttgccgagaacagagccgacagcagagggttgaactggcccagagcc
attgcgcctttcgaagtggctgtaattccgtcttccgccgtgaatgacgagatgctggcc
ttcttcgactccctcgttgatggcgggtcgtttgacgccgtgctggatgaccggaagaaa
gcgtttggatggaaaatgaaggatgccgatatcacgggatacccggttgttgttgttctc
ggcaaggcgtggagggagcgtggtgtttgcgaggttcaatgcagaagcctggagctcaaa
caagaagttgctgcatctgagcttccaatggtcttggagcagttgctgcaaaagctgtag

DBGET integrated database retrieval system