KEGG   Cordyceps militaris: CCM_06740Help
Entry
CCM_06740         CDS       T03108                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cmt  Cordyceps militaris
Pathway
cmt00052  Galactose metabolism
cmt00500  Starch and sucrose metabolism
cmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CCM_06740
   00500 Starch and sucrose metabolism
    CCM_06740
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CCM_06740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18168753
NCBI-ProteinID: XP_006671943
UniProt: G3JKU8
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MRLWGTLILPGLASAAGVMARADTGILDKCPGYTASNVQITDSGLTASLSLAGTACNVYG
DDIQDLVLQVTYETDNRLHVKIQDAANQVYQVPSSVFARSSSTSRASASQLRFTHTTAPF
SFAVARRDTGEVLFDTAAAALVFETQYLRLRTALPADPYLYGLGEHSDPFRLNTTAYVRT
LWNQDSFGIPNGANLYGAHPFYLEQRAAGGAHGVLLLNSNGMDIVVDQNPATGQQYLEYN
TLGGVLDLYFFAGPQPVDVARQYGALAGTPAMPPYWGLGYHNCRYGYQDAFEVAEVVHNY
SAAGIPLETMWTDIDYMDRRRVFSLDPERYPLATMRALVTHLHGRDQHYVVMVDPAVAYQ
DYPPLRRGLEQNAFLLRANGSAWVGVVWPGVAVFPDWFAETADSYWTNEFRLFFDKDDGV
DIDALWIDMNEPSNFPCNFPCDDPYAAAEGYPPPAPPVRATPRSLPGWPCEFQTGGCTSK
RDAAGTILVQTSNRNVAPFVNTDRLILPARAAGGDQKGLPGRDLLFPKYAIHNKAAYRDD
WNADRGGLSNHTVNTDVRHQNGLSMYDTHNMYGALMSTASHAAMLARRPGLRPLIITRST
FAGAGRTVGHWLGDNVSTWQKYRESIRGMLAFTALFQFNMVGSDVCGFAGTATEELCARW
ASLGAFYSFYRNHNEYGTPGQEFYRWESVTAAAKKAIDIRYRLMDYFYTAMQRASEDGTP
SIAPVFYHYPADQAAWALELQYFYGPAIMVAPVTEEGATSVDVYLPEDKYYDWYTHQVIR
GGRTHTFADVDVTTIPLLIRGGVVIPLRVKSANTTTELRKQDFELLVPLDENGTAAGELY
VDDGVSVTQKPGGVTDVQFKYEKGVLSISGTFAVDALPRITKVTVLGEGCKTKHAAVAGA
SEDGRRSRSVNVDISLNVASTINI
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgagactctggggaaccttgatcctaccggggctggcctctgcggccggcgtcatggcc
cgcgcagacaccggcatcctcgacaagtgcccggggtatacagcctccaacgtgcagatc
accgactcggggctgacggcgtccctgtccctcgccggcaccgcctgcaacgtctacggc
gacgatatccaggacctcgtcctccaagtcacctacgagaccgacaaccgcctgcacgtc
aagatccaggatgccgccaaccaagtgtaccaggtgccctcgtccgtctttgcgcggtcc
tcgtccacctcgcgcgcctcggccagccagctgcgcttcacccacacgaccgcgcccttt
tcctttgccgtcgcgcggcgcgacaccggcgaggtgctgttcgacacggccgcggcggcg
ctcgtctttgagacgcagtacctgcgcctgcgcaccgccctgcccgccgacccgtacctg
tacggcctcggcgagcactcggacccgttccggctcaacacgacggcgtacgtccgcacg
ctctggaaccaggacagcttcggcatccccaacggcgccaacctgtacggcgcgcacccg
ttctacctggagcagcgcgcggccggcggcgcccacggcgtgctgctgctcaactccaac
ggcatggacattgtcgtggaccagaaccccgccaccgggcagcagtacctcgagtacaac
acgctcggcggcgtgctcgacttgtacttctttgccggcccgcagcccgtcgacgtggcg
aggcagtacggcgccctggccggcacgcccgccatgccgccgtactggggcctgggctac
cacaactgccgctacggctaccaggacgcgttcgaggtcgccgaggtcgtgcacaactac
agcgccgccggcatcccgctcgagaccatgtggaccgacattgactacatggaccgccgc
cgcgtcttctccctcgacccggagcggtaccccctcgccaccatgcgcgccctcgtcacc
cacctgcacggccgcgaccagcactacgtcgtcatggtcgaccccgccgtcgcctaccag
gactacccgccactgcgccgcggcctcgagcaaaacgcgtttctgctccgcgccaacggc
tccgcctgggtcggcgtcgtgtggcccggcgtcgccgtcttcccggactggttcgccgag
acggccgacagctactggacaaacgagttcaggctcttctttgacaaggacgacggcgtg
gacattgacgccctctggatcgacatgaacgagcccagcaactttccctgcaactttccc
tgcgacgacccgtacgcggccgccgagggctatccgccgcccgcgccgcccgtgcgcgcc
acgccgcgctcgctgcccggctggccgtgcgagttccagaccggcggctgcaccagcaag
cgcgacgccgccggcaccatcctcgtccagacaagcaaccgcaacgtcgcgccgtttgtc
aacaccgaccgcctgatcctccccgcgcgcgccgccggcggtgaccaaaaaggcctgccc
ggccgggacctgctgttccccaagtacgccatccacaacaaggccgcgtaccgggacgac
tggaacgcggaccgcggcgggctctccaaccacaccgtcaacaccgacgtgcggcaccaa
aacgggctcagcatgtacgacacgcacaacatgtacggcgccctcatgtccacggcctcg
cacgccgccatgctcgcgcgccgcccgggcctgcggccgctcatcatcacccggagcacc
tttgccggcgccggccgcacagtcggccactggctgggcgacaacgtctcgacgtggcaa
aagtaccgcgagtccatccgcggcatgctcgcctttaccgcgctcttccagttcaacatg
gtgggctccgacgtgtgcggcttcgcgggcaccgcgaccgaggagctgtgcgcgcgctgg
gccagcctgggcgcgttttacagcttctaccgcaaccacaacgagtacggcacgccggga
caggagttttaccgctgggagagcgtgacggcggcggccaagaaggcgattgatatccgg
tacaggctgatggactacttttacaccgccatgcagcgcgccagcgaggacggcacgccg
agcatcgcgcccgtcttttaccactaccccgcggatcaggccgcgtgggcgctcgagctg
cagtacttctacggtccggccatcatggtcgcgcccgtcacggaagagggcgccaccagc
gtcgacgtgtacctccccgaggataaatactacgactggtacacgcaccaggtgatccgc
ggcggccgcacgcacacatttgccgatgtcgacgtgactactattccgctgctcatccgc
ggcggcgttgtcatcccgctgcgcgtcaagtcggccaataccacgacggagctacgcaag
caagattttgagctgctcgtgccgctggacgagaacggtaccgcggctggcgagctgtat
gtcgacgacggcgtgtcggtgacgcagaagccgggcggtgtgaccgacgtccagttcaag
tatgaaaagggcgtgctgagtattagcggcacgtttgctgtggacgcactcccgcgcatt
actaaagtgacggtgttgggtgaaggatgcaagacgaagcacgcagcagtagcaggtgcg
tccgaagacggtaggaggagccggtcggtcaatgtggacatttcgctcaacgtggcgagt
acgatcaacatttga

DBGET integrated database retrieval system