KEGG   Cordyceps militaris: CCM_07336Help
Entry
CCM_07336         CDS       T03108                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cmt  Cordyceps militaris
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmt03036]
    CCM_07336
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CCM_07336
Chromosome and associated proteins [BR:cmt03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CCM_07336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl SMN
Motif
Other DBs
NCBI-GeneID: 18169347
NCBI-ProteinID: XP_006672540
UniProt: G3JQQ8
LinkDB All DBs
Position
Unknown
AA seq 1192 aa AA seqDB search
MRTPSTASTPSRRLSAHTTTAVSARDDDNGITQSLSQLSLLTSGEHHAGSAVPRGGGGAL
RQPSSTSRRTSVSPSHRIPSRSPSGRDSRPTTPTLLRKASMNSLHSANGHGPGRAPSRRA
SMTQTMSSPKITARSPSVGSLPPAEEQKQPPLTAASVAANYFRAEMQIHHGPDATLPSET
VVILHDAVYGHRFARPRTSRSALSTIVERPERVKAAVLGVSLAYVRLGERHDEGAYPLHP
KAKIRDIPKIPFRIRKSTRTVSLTSAAVTNVHGTKWMEELKTMCDTAESKLALGGRELQR
PDNTERDEPAQPLHEGDLYLCAESLDAMEGALGAVCDGVDAVFSPAPAPRRAFVAVRPPG
HHCAAAHPSGFCWVNNVLVGIMHGALTHGLTHAAIIDFDLHHGDGSQAIVWQHNARANAA
TKNFQQWKKTSIGYFSLHDINSYPCEMGDEEKVKNASLCIDNAHGQSIWNVHLQSWKTER
EFWDIYESKYSVILEKTRIYLREQAKKLRAEGKEPKAAIFFSAGFDASEWESAGMQRHQV
NVPTEFYARLSQDVVRIANEHGLYVGGRVISVLEGGYSDRALFSGVFSHLSGLVGNQSMQ
TLDAARGLGYEMGQKLGTIAEPGPEATEMQAPAGPSLHQYDASWWSSQHLDALESLITHP
QSPPRKPRTGTPPTYFSPTHASSAKVMDPVKVRRSLSGLSSTIQRPRAASPVAPDVPWTV
AAHELSKVLIPSDRQVDSCRAEDLNAEATRARRDKQSILLGIPIPPTPVPQERPTSRMAL
RERRTKAASSCSTDDGPAAHRTPASPSKRSSSRGARAKSTEAEQASFAALHRRRSRRLSE
SATSQSPSKEDAVPVPPLPAEYEQTSGSSRAGSSMSGGQLPELARGPLLPPPPSNLHVKK
TRQRGGPAAAAAPTPKETTPKTPRAARPAATPSSKARTAPAGAGKPRQQSRPPAPASRPP
VPPAVDNITTGMRKIKINLITQSQREANNALQQHTSAARPPAAATAAPGVLDERPAPTVL
SATEPSPLQQAPSDAGFLSRSTASGLSTPLDEQSMIDSPSPLEKKTAAAADAVSPVADDV
TTSQGGLFINYQPEGPAPVAVVQRGGGGGNGSLQWLEPNVPTPSATTPAVTPSPVKKKQG
GVSQLFQYTSSGIPFAPRPGSSGQRGAAVGGLEKPKEEAKATALWAVPETRT
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgcctagcaccgcctcgacgccgtcgcgccgactgtctgcccacaccaccacg
gccgtgtccgccagggacgacgacaatggcatcacgcagtcgctcagccagctgtcgctg
ctgacctcgggcgaacaccacgccggaagcgcggtcccgcgcggcggcggcggcgcgctc
agacagccctcgtcgacatcgcgacgcacctcggtctcgcccagccaccgcataccctcg
cgcagcccgtccgggcgcgactcgcggccgacgacgccaaccctgctgcgcaaagcctcg
atgaactcactgcactcggccaacggccacgggcccggccgcgcgccctcgcgccgcgcg
agcatgacccagaccatgtcgtcgcccaagataaccgcccgctcgccgtcagttggcagc
ctgccgcccgccgaggagcagaagcagccgccgctgacggccgcgtccgtcgccgccaac
tactttcgcgccgagatgcagatacaccacggcccggacgcgacgctgccgtccgagacc
gtcgtcatcctacacgacgccgtgtacggccaccgcttcgcccggccgcgcacgtcgcgc
agcgcgctgagcaccattgtcgagcggcccgagcgagtcaaggcggctgtgctgggtgtg
tccctggcctatgttcggctcggcgagcgccacgacgagggagcgtacccccttcacccc
aaagccaagattcgcgacatccccaagattccgtttcgtattcggaaatcaacgcgaacc
gtgtccctgacgtcggctgcggtgacaaatgtgcacggcacgaaatggatggaggagctg
aaaaccatgtgcgacacggccgaatccaagctggccttgggtggccgagagctgcaaaga
cccgacaacactgaaagagacgaacctgcacaaccactgcatgaaggcgacttatattta
tgcgccgaatcgttggacgccatggagggtgctcttggcgccgtatgcgacggtgtagac
gctgtcttcagcccggccccggccccgcgacgcgcatttgtggctgtgagaccaccaggt
caccattgcgccgcggcgcacccttcaggcttttgctgggtgaacaatgtactggtggga
atcatgcacggcgctctcacacacgggctgacacatgctgccattatcgattttgacctg
caccacggcgacggatcgcaagccattgtctggcagcacaatgcgcgtgccaatgcggcg
accaaaaactttcagcagtggaagaagacttccataggatatttcagcttgcacgacatt
aattcctatccctgtgagatgggcgacgaggaaaaggtcaagaatgcttccctctgcatt
gacaatgctcatggacagagcatctggaatgtccacttgcagtcttggaagacagaaagg
gagttttgggacatttacgaatcaaaatactcggtgattttggaaaagacgcgcatctat
ctccgtgaacaagcaaagaagctccgagcagaggggaaggagcccaaggcagccatcttc
ttctcggccggttttgatgccagcgagtgggagagcgcaggcatgcagagacaccaagtc
aacgtccccactgaattttacgctcgactcagccaagacgttgtcagaatcgccaacgaa
cacggtctttatgttggcggccgtgtgattagcgtcttggaaggaggttacagcgacaga
gccttgttctccggtgtctttagtcatctgagcggcctggtcggcaaccagtcgatgcag
acattggacgcagcgcgcggcctcggctacgagatgggccagaagctgggcaccattgcc
gagcccggccccgaagccacggagatgcaggcccccgccggcccgtccctgcaccagtac
gacgccagttggtggtccagccagcacctcgacgccctcgagtctctcatcacgcacccc
cagtcccctccccggaagccgcggaccggcacgccgcccacgtacttttcgcccacgcac
gcgtcgtcggccaaggtcatggaccccgtcaaggtgcgccgcagcctgtcggggctctcg
tcgacgattcagcggccgcgcgccgcgtcgcccgtcgcgcccgacgtgccgtggaccgtg
gcggcgcacgagctcagcaaggtcctcatccccagcgaccggcaagtggacagctgccgc
gccgaggacctcaacgccgaggcgacgcgcgcgcgacgcgataaacagtcgatccttttg
ggtatccccattccgccgacgcctgtgccgcaagaacgaccgacgtcccgcatggcgctc
cgagagcgcaggaccaaggcggcgagctcatgttccacggatgacggccccgccgcccac
aggacccctgcgtcgccgagcaagcgatcctcgtcccgtggggccagggccaagtcgaca
gaggccgagcaggcctcctttgctgccttgcatcgccgacgctcccgccgtctcagcgag
tcggccacgtcgcagagcccgagtaaggaagacgccgtgcccgttccgccgctacccgcc
gagtacgagcagacgtctggcagcagccgcgccggctctagcatgagcggcggccagctc
ccggagctcgcgcggggtccactactgccgccgccgccatccaatctacacgtcaagaag
acgcggcagcgaggcggaccggcggcggcagcagcccccacgcccaaggagacgacgccc
aagacgccccgcgccgcacgccccgctgcaacaccgtcgagtaaggccaggacggcgccg
gcgggcgccggcaagccgcgacaacagagccggccacccgcgccagcgtcgagaccgccc
gtgcccccggccgtggataacattaccacgggtatgcgcaagatcaagattaacctgatt
acgcaatcccaaagggaggccaacaatgccctccagcagcacacgtcggcggcaaggccc
cctgctgctgctactgctgcgccgggcgtgctcgatgagcgccccgcaccgacagtctta
tccgcgaccgagccgtccccattgcagcaggcgccgtctgacgctggctttctcagccgg
agcaccgcctcggggctctcgacgccgctcgacgagcagtccatgattgactcgccgtcg
ccgctcgagaagaagactgcggcggcggccgacgccgttagccccgtcgctgacgacgtg
acgacgagccagggcggcctgttcataaactaccagcccgaggggccggcgcccgtggcg
gtggtccagcgcggcggcggcggcgggaacggctcactccagtggctggagcccaatgtc
cccacgccctcggcgacgacgcccgcggtgacgcccagcccggtcaagaagaagcagggc
ggcgtgtcgcagctgttccagtatacatcctcgggcattccgtttgcgccaagacccggg
agcagcgggcagcgaggggcagcggtcggcggtttggagaagcccaaggaggaggcgaag
gcaacggccttgtgggcggttccggagacgcgcacatga

DBGET integrated database retrieval system