KEGG   Cordyceps militaris: CCM_08506Help
Entry
CCM_08506         CDS       T03108                                 

Definition
(RefSeq) isocitrate dehydrogenase Idp1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cmt  Cordyceps militaris
Pathway
cmt00020  Citrate cycle (TCA cycle)
cmt00480  Glutathione metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
cmt01130  Biosynthesis of antibiotics
cmt01200  Carbon metabolism
cmt01210  2-Oxocarboxylic acid metabolism
cmt01230  Biosynthesis of amino acids
cmt04146  Peroxisome
Module
cmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCM_08506
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCM_08506
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CCM_08506
Enzymes [BR:cmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CCM_08506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18170513
NCBI-ProteinID: XP_006673707
UniProt: G3JRS2
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MSASISRLLRTSRAAPLTVLRASSSRPTFGALQTYSPAAFRTMATSHKIKVKNPVVELDG
DEMTRIIWQSIKDKFIHPYLDIDLKYYDLGLEYRDQTDDQVTLDAAEAIKKYSVGVKCAT
ITPDEARVEEFKLKKMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAF
GDQYRAKDRVIPGPGRLTMVYTPEGGQPEELEVFDFKTGGGVAQTQYNTDESITGFAHAS
FKLALDKGYPLYMSTKNTILKKYDGRFKDIFQEIYDSTYHKEFEAKKIWYEHRLIDDMVA
QMMKSSGGYIMALKNYDGDVQSDVVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHY
REHQKGRETSTNPIASIFAWTRGLVQRGKLDDTPDVVAFAEALEQACIDTVDVDGVMTKD
LALACGKTGREDYVTTTEYLTAVERRLKQSFTQGKL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctccatctcaaggcttcttcgtacatcccgcgccgctcctctcaccgtcctc
cgcgcttcttcctctcgtcctacctttggcgctctccagacctactcccccgccgccttt
cgcaccatggccacctcacacaagatcaaggtcaagaaccccgtcgtcgagctcgacggc
gacgaaatgacccgcatcatctggcagagcatcaaggacaagttcatccacccctacctc
gacattgacctcaagtactacgaccttggtctcgaataccgcgaccagaccgacgaccag
gtcacccttgacgccgccgaggccatcaagaagtactctgttggtgtcaagtgtgcaacc
attacccccgacgaggcccgcgttgaggagttcaaactgaagaagatgtggctatccccc
aacggcaccatccgcaacgccctcggcggcaccgtcttccgtgagcccattgtcatcccc
cgcatcccccgcctcgtccccggctggaagaagcccatcatcatcggccgccatgccttt
ggcgaccagtaccgcgccaaggaccgcgtcatccccggccccggccgcctcaccatggtc
tacacccccgagggcggccagcccgaggagcttgaggtcttcgactttaagacgggcggc
ggcgtcgcccagacccagtacaacacggacgagtccatcaccggcttcgcccacgcctcg
ttcaagctcgccctcgacaagggctaccccctctacatgagcaccaagaataccattctc
aaaaagtacgacggccgcttcaaagacatcttccaggaaatctacgacagcacctaccac
aaggagtttgaggccaaaaagatttggtacgagcaccgcctcattgacgacatggtggcc
caaatgatgaagagctctggcggctacattatggctctcaagaactacgacggcgatgtc
cagtccgatgtcgtcgcccagggcttcggctccctcggcctcatgacctctgtcctcatc
acgcccgacggcaagaccttcgagtccgaggccgcccacggcaccgtcacccgccactac
cgcgagcaccaaaagggccgcgagacgtcgacgaaccccatcgcctccatctttgcctgg
acccgcggcctcgtccagcgcggtaagctcgacgacacccccgacgtcgtcgcctttgcc
gaggccctcgagcaggcctgcatcgacacagtcgacgtcgacggcgtcatgaccaaggac
ctcgccctcgcctgcggcaagaccggccgcgaggattacgtcaccaccaccgagtacctg
actgccgtcgagcgtcgcctcaagcagagcttcacccagggcaagctgtaa

DBGET integrated database retrieval system