KEGG   Cordyceps militaris: CCM_08811Help
Entry
CCM_08811         CDS       T03108                                 

Definition
(RefSeq) glucoamylase I precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cmt  Cordyceps militaris
Pathway
cmt00500  Starch and sucrose metabolism
cmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCM_08811
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CCM_08811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 CBM53
Motif
Other DBs
NCBI-GeneID: 18170816
NCBI-ProteinID: XP_006674010
UniProt: G3JSH3
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MDGRALSSFWNTSSVSFAQPIMHGLGSVLLLGTLAAQKVLGLPGTSTQCIQRRNIDSFVS
SEGPIALQKLLCNIGSDGCEAQSAAPGAVAASPSTSNPNYWYTWTRDSALVFKCLVDRFT
HSYDSNLQTLIQDYIAAQAKLQGVSNPSGSLSDGAGLAEPKFNVDLSAFTGPWGRPQRDG
PALRAIAMISYAHWLIDNGYIDTASDIVWPVVQNDLNYVAQYWNQTGFDLWEEVNGSSFF
TVASQHRSLVEGGSLAAKLSKDGSVYSQVAPQILCFLQTFWVSSSGYINSNINQNNGRTG
KDVNSILTSIHNFDAALGCDTSTFQPCSDKALSNHKVVVDSFRFYSINKGISEGKGVAIG
RYSEDVYYNGNPWYLATMAAAEQLYDALHIWKQQGSITVTRTSQAFFGDFVPNIAPGTYS
SDSSTFATVVQAVMSYADEFVAIVAKYTPSSGALAEQFDKNNGSPLSARDLTWSYASLLT
AIDRRAGIIPPPWASDGANQIPGSCAGKTVAGSYTSATATSFPANQTPKTGVPPTSTAPA
QPTCTPAMSVAVTFRETVTTQLGQTIKIVGNTAELGNWDTSRAVALEASEYTADNNVWKG
TVTLPAGKAIEYKFVNVQADGTVVWEADPNHSYTVPKTCATTASRADTWQ
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatggccgtgcattatcatcattctggaatacttcttccgtctcctttgcacagccc
atcatgcatggtctcggtagtgttctgttgctcggcacccttgcggcccaaaaagtgcta
ggcctgcctggcaccagcacccaatgtattcagaggcgcaacatcgacagcttcgtttct
tccgaaggacccattgcgctccagaagctgctctgcaacattggctcggacggctgcgaa
gcgcagtcggcggccccgggcgccgtggcggcgtcacccagcacgagcaaccccaattac
tggtacacatggacacgagacagcgccttggtgttcaagtgcctcgtggaccgattcacc
cattcatatgatagcaacctgcaaacgctcatccaagactacattgcagcccaagccaag
ctgcagggcgtttccaacccgtcaggctccctgtccgacggcgccggcctggccgagccc
aagttcaacgttgacctttctgcctttaccggcccgtggggacgaccgcagcgggacggt
ccggcgctgcgggcgattgccatgatttcgtatgcgcactggctcattgacaatggatat
atagacacggctagcgacattgtctggcccgtcgtgcaaaacgacctcaactacgtcgcg
cagtactggaaccagactggctttgacctgtgggaggaagttaacggcagctcctttttc
accgtcgcaagccagcaccgatctctggtcgagggcggcagtctggccgccaagctgagc
aaggacggctcggtgtacagtcaagtggcacctcaaattctttgcttcttgcagacgttc
tgggtgtcctctagcggatacatcaattcgaacatcaaccaaaacaatggccgcacgggc
aaagacgtcaactcgattctgacatcgattcataactttgatgccgcgctcggatgcgac
accagcacgtttcagccgtgcagcgacaaggcgctctcgaaccacaaggttgttgtggac
tcgttccgattctacagcattaacaagggcatctcggagggcaagggtgtggctattggt
aggtactcagaagatgtgtactacaatggtaacccttggtatctggcgaccatggctgca
gctgagcagctttacgatgcgctgcacatttggaagcagcaggggtccattactgtgacg
agaacgtcgcaggccttctttggtgattttgtgcccaacattgccccaggcacatactct
agcgactcgagcacatttgctaccgttgtgcaggccgtcatgtcgtatgcagatgagttt
gtggccattgttgccaagtacacgccgtcgagcggtgcattggctgagcagtttgacaag
aacaatggctctccgctgtcggcccgcgacctgacctggtcctacgcatcgcttctcaca
gccattgaccgccgcgccggcatcatcccgccgccctgggccagcgacggcgccaaccag
atacctggatcctgcgctggcaagacggttgcaggcagttacacgtcggcgacagcaacg
tcgttccccgcgaaccaaacgccgaagacgggtgttccaccaacgtcgacggcgcccgcg
cagccgacgtgcacccccgcgatgtcagtggccgtcacattccgcgagacggtgacgacg
cagcttgggcagaccatcaagattgtgggcaacacggcagagctcggcaactgggacact
agccgggcggtggcgctcgaggcgagcgagtacacggcggacaacaacgtgtggaagggg
acggtgacgctgccggctggcaaggcgatcgagtacaagtttgtaaatgtgcaggcggac
gggacggttgtgtgggaggcggatccgaaccacagctacacggtgcccaagacgtgcgcg
acgacggcgtcgagggcggacacctggcagtga

DBGET integrated database retrieval system