KEGG   Cordyceps militaris: CCM_08965Help
Entry
CCM_08965         CDS       T03108                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmt  Cordyceps militaris
Pathway
cmt00410  beta-Alanine metabolism
cmt00430  Taurine and hypotaurine metabolism
cmt00650  Butanoate metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
Module
cmt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCM_08965
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCM_08965
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCM_08965
   00430 Taurine and hypotaurine metabolism
    CCM_08965
Enzymes [BR:cmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CCM_08965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 18170969
NCBI-ProteinID: XP_006674163
UniProt: G3JSS2
LinkDB All DBs
Position
Unknown
AA seq 523 aa AA seqDB search
MVHLSRVQTGLTDPKGAAASDLHHKAAQLHLAEYNDEFTTSVYGSRFAREDLPKNCMPEG
EMPKEVAYQMIKDQLSLDGNPKLNLASFVSTYMEEEAIKLMTDAFPTNFIDYEEYPYTAD
IQNRCVNMIANLFNAPAEDAIGTSTVGSSEAIMLAVLAMKRRWKQARQAAGKSTEHPNII
MSSAVQVCWEKAARYFEIDEKYVDCTRERFVIDPETAVSLVDENTIGIVSILGTTYTGHY
EDTKAINDLLVAKNIDCPIHVDAASGGFVAPFVVPDLEWDFRLPKVVSINVSGHKYGLVH
PGVGWAVWRSCEYLPKDLIFNINYLGAEQSSFTLNFSKGASQVIGQYYQLIRLGKHGYRA
IMSNLVRTADHLSDRLQELGFIIMSEKSGDGLPLVAFRFPAGKEKGAVEDRVYDEFALAA
HLRARGWIVPAYTMAPKTDGLKMLRVVCREDFSRSRADDLISDIGLCLGLLATSDKESLD
RAKKYVQQHVSSHSKKNHKHTVHEYKNEEHSLQGKTGKTHAIC
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctctcccgcgttcagaccggcctcacggatcccaagggcgccgccgcctcg
gacctccaccacaaggccgcgcagctgcacctcgccgagtacaatgacgagtttaccacg
tccgtctacggctcgcgcttcgcccgcgaggacctgcccaagaactgcatgcccgagggc
gagatgcccaaggaggtggcctaccagatgatcaaggaccagctgagcctcgacggcaac
cccaagctcaacctggcttcattcgtctcgacctacatggaagaagaagccatcaagctc
atgaccgacgccttccccaccaacttcatcgactacgaagagtacccctacaccgccgac
attcagaaccgctgtgtcaacatgattgccaacctcttcaatgcccccgccgaagacgcc
attggcacttccactgtcggctcctccgaggccatcatgctcgccgtccttgccatgaag
cgccgctggaagcaggcccgccaggccgccggcaagtccactgagcaccccaacatcatc
atgtcatcagccgtccaggtctgctgggaaaaggcggcccgctattttgagattgacgaa
aagtacgtcgactgcacccgcgaacgcttcgtcattgaccccgagacggccgtctcgctc
gtcgacgagaataccattggcatcgtctccatcctcggcaccacttacacgggccactac
gaggacaccaaggccatcaatgacttgctcgtcgccaagaacattgattgccccatccat
gtcgacgctgcttctggtggcttcgtcgcgccttttgtcgtcccggacctggaatgggat
ttccgcctgcccaaggttgtctccatcaacgtctccggccacaagtacggcctcgttcac
cccggcgtcggctgggccgtctggcgctcttgcgagtacctccccaaggaccttatcttc
aacatcaactacctcggcgccgagcagtcgtcctttaccctcaacttctccaagggtgcg
tcccaggtcattggccagtactaccagctgatccgcctcggcaagcacggttaccgcgcc
atcatgagcaacctggtccgcaccgccgaccacctgtcggaccgtctccaagagctcggc
ttcatcatcatgtcggagaagtctggcgacggcctgccgcttgtcgctttccgcttcccc
gctggcaaggagaagggcgccgtggaggaccgcgtctatgacgagttcgccctcgctgcc
cacctgcgcgcccgtggctggatcgtgcccgcttacaccatggcccccaagacggacggt
ctcaaaatgctgcgcgtcgtctgccgcgaagacttttcccgcagtcgcgccgacgatctc
attagcgacattggcctctgtctcggcctgttggccacgtcagataaggagtcgcttgac
cgcgccaaaaagtacgtccagcagcacgtctcgtcgcacagcaagaagaaccacaagcac
actgtccacgagtacaagaacgaggagcactctctccagggcaagacgggtaagacgcac
gccatttgttaa

DBGET integrated database retrieval system