KEGG   Corynebacterium mustelae: CMUST_03400Help
Entry
CMUST_03400       CDS       T03941                                 

Definition
(GenBank) molecular chaperone of HSP90 family
  KO
K04079  molecular chaperone HtpG
Organism
cmv  Corynebacterium mustelae
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmv01009]
    CMUST_03400
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmv03110]
    CMUST_03400
   04131 Membrane trafficking [BR:cmv04131]
    CMUST_03400
   03051 Proteasome [BR:cmv03051]
    CMUST_03400
   03029 Mitochondrial biogenesis [BR:cmv03029]
    CMUST_03400
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmv04147]
    CMUST_03400
Protein phosphatases and associated proteins [BR:cmv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CMUST_03400
Chaperones and folding catalysts [BR:cmv03110]
 Heat shock proteins
  HSP90
   CMUST_03400
Membrane trafficking [BR:cmv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CMUST_03400
Proteasome [BR:cmv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CMUST_03400
Mitochondrial biogenesis [BR:cmv03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    CMUST_03400
Exosome [BR:cmv04147]
 Exosomal proteins
  Proteins found in most exosomes
   CMUST_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c Lact_bio_phlase
Motif
Other DBs
NCBI-ProteinID: AKK05024
UniProt: A0A0G3GV35
LinkDB All DBs
Position
701405..703246
Genome map
AA seq 613 aa AA seqDB search
MSEFITDPHTPNPSGSNGGSFHVDLGGIVELLSKNLYTSSNVYVRELLQNGVDAITARRG
IDPEFDNYDRPKIRFIVEPRVLRVIDNGIGLNYEQAQQLLSTIGGSSKRDEFGLGRSDFL
GQFGIGLLSCFLVSNDIVVYSASAAAPAIKWHGKSQGTWTVTEHEPPMLLHGCGTLVELQ
AIPGEPDFDMFSLSQTIEHYAAFLPVEITIERAVNGVCSGEAVTLGGQKPVWEAPITAQA
AWCRENFGFEPLAAIPLDVAIAGLNGVAFVMSEGTHPGRTAKHQLYLRRMLLSKKNTDIV
PEWAYFVRIVADAEFLRPTASRDALVEDSLFDETKEAIGHQIRVWINSLNEQDFLRFLSL
HMAGLKALAVSDSETRELVTKWVPFETSTGRKTLDELLKSGGIRYYRTDQKYQSVLPIAR
ANELTVLNAGYAYDQEILDQLRLDYPDQVIVEASLHDVIGVMGVLGPDQEAGFLPLMRIA
QEALDGQDVSVIVRDFQPSTVPVLFLAAEEADYGSIEKAAREAEGESSLAGLLDSMDSIM
PMHVVDNTAQVIFNVQSPLIHQLLAAVGMGNDVLTQAIRGLYVQSLLAGRHNMNIQARTW
ASEMYSTLISKLL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagtttattactgacccccacacccccaatccatccggcagcaatggtggatca
ttccacgttgatttgggtggaattgtggagttgctcagtaagaacctctacaccagctcc
aacgtgtatgtgcgggagttgctgcaaaacggtgtcgatgcgattactgctcggcgcggt
attgacccagaattcgacaattatgaccgccccaagatccggttcatcgtggaaccccgc
gtactacgagtgatcgataacggtattgggcttaactatgaacaagctcagcaattacta
tcgacgatcggcggatcatctaaacgagatgaatttgggttggggcgaagtgactttctc
ggccaatttggcatcggcttattatcgtgttttttagtgtccaatgacattgtcgtctac
tcagctagtgccgccgcaccagccattaaatggcatggaaaatctcaaggtacgtggaca
gtaacagaacacgaaccccctatgctgttgcacggctgcggcacgctggtggaattacaa
gcgattcctggcgaaccggactttgacatgtttagcttgtcgcaaaccatagaacactat
gcggcatttttgccggtagaaataactattgaacgcgcggttaatggcgtgtgctctggt
gaagctgtaactttgggtgggcagaagccagtgtgggaagcccccattacagcacaagca
gcgtggtgtcgagaaaactttggatttgaaccattggcagctattccgctggatgttgct
atagcggggctcaacggggttgcctttgtcatgtcggaaggaacgcatccggggcgaacc
gcaaaacaccagctgtatctacgtcgaatgttattaagcaagaaaaacaccgacatcgtt
ccggaatgggcgtattttgtgcggatcgtagcggatgcggaattcctgcgccccactgcc
tcccgcgatgcactggtggaggattcgcttttcgacgagaccaaagaagccatcggacac
caaatccgggtttggatcaatagcctaaacgaacaggattttttgcggtttttgagcctg
cacatggccgggctgaaagcccttgccgtttcggacagtgaaactcgcgaattggtgacc
aagtgggtgccattcgaaaccagcacgggacgaaagacacttgatgaattgttgaaatct
ggcggaattcgttactaccgcactgaccagaaataccaatctgtattgccgattgcgcgg
gcaaatgaactgacggttttaaatgctggctatgcttatgaccaagaaatccttgatcaa
ctgcggttggactacccagatcaggttatcgtcgaagccagcttgcatgatgttattggg
gtcatgggggtattaggcccagaccaagaagctggatttctaccgttgatgcgtatcgcc
caagaggcattggatggccaagatgtgtcggttattgtgcgggattttcagcctagtacc
gtgccagtgttgttcttagcggcggaagaagccgactacggttccatagagaaagctgcg
cgggaagctgaaggcgaaagttcgctagcgggtttgctcgatagcatggactccatcatg
ccaatgcatgtggtggacaataccgcccaggttatttttaatgttcagtccccattgatc
catcagttacttgcggctgtgggtatgggcaatgatgtgttaacccaggctatccggggg
ctttacgttcaatcgttattagcgggacgccacaatatgaatatccaagcacgaacgtgg
gcttcagaaatgtattccaccttgattagcaaacttctgtaa

DBGET integrated database retrieval system