KEGG   Corynebacterium mustelae: CMUST_10940Help
Entry
CMUST_10940       CDS       T03941                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cmv  Corynebacterium mustelae
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmv01001]
    CMUST_10940
Enzymes [BR:cmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CMUST_10940
Protein kinases [BR:cmv01001]
 Serine/threonine kinases: Other
  Bacterial family
   CMUST_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Haspin_kinase Pkinase_fungal Kinase-like RIO1 Kdo DUF3077
Motif
Other DBs
NCBI-ProteinID: AKK06503
UniProt: A0A0G3H3U5
LinkDB All DBs
Position
2423351..2425576
Genome map
AA seq 741 aa AA seqDB search
MQLKLGDFLEHRYRIEAPIARGGMSTVYRCVDTRLGRTVAAKVMDDQYVGDPIFSDRFQR
EARSMAQLSHPNLVGVYDFSSEGDNIFLIMELINGGTLRELLEEQGPLPAYAAVSVLRSI
LQGLAAVHAAGLIHRDLKPDNVLINSQNQVKLSDFGLVRAAAASNATSNQIIGTVSYLSP
EQVSGDDITMASDVYSAGILLFELLTATTPFAGDSQISRAFARLDSDVPAPSSRVSGVPK
LIDELVATATARNPEERFADAAEFLTALEDVARELDFPPYIVPVPKNTATQRAAAHVASL
TDADATTVIGSVNDNADAPTTVVGSPNMTMQLPPSAPEETSVFPTAVPEVAPPPQPVVAQ
PHPDVDTPAVVESLSPAPVVTNRGRGGIVVWWIVVAIITTAIAIGAWWFGSGRYGEVPQV
LGMDQTTASQTLADHGFGTAIATVYDDDIPVDLVAGTKPASGSQAVKGDDVTLLVSLGKP
TVPDFAEQPDVSAYRAALSSRTLQYSEGESVYSDSVEEGKIAEVSPGVGSEVPVNSTITV
HLSKGPTPVNVPNVRDQSREEAIGQLRNAGFDVTVETRFDDSVAGEHAIGTQPEAGSQIP
KGSKITLHVSTATEIPDLFGLTEREARSLLAESGIRVAEVIRSEDSSAVGETASDVYESS
PPSGTLIDSSQTAVTIVLVGEVEVPNVVGKRLSEARRILHDAGLEAKVATSASNSSRVLY
QSPTIFSTLAPGEEVELRVLN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgaagttgggagattttctcgaacatcgctaccgcattgaggcgcctatcgca
cgcggcggcatgtcaacggtgtatcgctgtgtggatactcgtctggggcgaaccgttgca
gccaaggtcatggatgaccagtacgttggcgatcccatcttctccgaccggtttcaacgt
gaagcccggtcaatggcgcagctctcccacccaaatttggtgggggtgtacgatttcagc
tcagagggagacaacatcttcctcattatggagctgattaacggcggtaccttaagagaa
ttattggaagaacaggggccattaccagcctatgctgcggtgtcggtgctgcgttcgatt
ttgcaggggttagcggctgtgcacgccgctgggcttatccaccgcgatttgaaaccagac
aacgttcttattaactcgcagaaccaggtcaaactatccgactttgggctagttcgggca
gcagcggcatctaatgccacctcgaatcagatcatcggcacggtttcttatttgtcgcca
gagcaggtaagcggcgacgacatcaccatggcgtcggatgtgtactcggccggaatttta
ttattcgagcttttaaccgcaacaactccgtttgctggcgattcccaaatttctcgggca
ttcgcacgtctcgattcagatgttcccgcacccagcagcagggttagtggtgtaccgaag
cttatcgacgaattggtggccaccgctaccgcccgcaatccagaggagcggtttgccgat
gcggcggaattcttaacggcactagaagacgtagcacgggaactcgactttccgccgtat
atagttccggtaccgaagaacacggcaacccagcgcgccgccgcccacgtcgcgtcgtta
accgacgcggatgccaccacggtgataggaagtgtcaacgacaacgccgacgcccccacc
acggtggtaggtagccctaatatgaccatgcaattgcccccaagcgctccggaagaaacg
tcggtgtttcccacagcggtacccgaagtggcaccaccaccgcaaccggtagtcgcgcaa
cctcatccagatgtcgataccccagccgtggtggaatcattatcaccggcaccggtggtc
accaatcggggccgcggcggaatcgtcgtctggtggatcgttgtagcgataatcaccaca
gcaattgcgatcggcgcgtggtggtttggctctggaagatacggcgaagtgccgcaagta
ttggggatggatcaaaccacagcaagccagacccttgctgaccacgggtttgggacagcg
atagcgacggtgtatgacgatgatattccggtcgatttagttgctggaactaaaccggcc
agcggcagccaagcggtaaagggtgacgatgtcacccttttggtgtcattgggcaaacca
acggttcctgactttgcagagcaaccagatgtttccgcctaccgcgccgcgctgtcatcg
cgaacattgcagtacagcgaaggcgaatcggtgtactccgattccgtcgaagaaggaaaa
atcgcagaggtatcccctggcgtaggcagcgaagttcccgttaatagcacgatcaccgta
catctatccaagggcccaacacccgtcaacgttccgaacgtgcgggaccaatcccgagaa
gaagccattggccaattgcgtaatgccggttttgatgtgacggtggaaacccgattcgat
gattctgttgcgggagagcatgcaattggcacacaaccggaggcgggttcccagattccc
aaaggcagcaaaattaccctccatgtctccaccgcaaccgagatccctgatcttttcggt
cttaccgaacgagaagcccgcagccttttggcggaatcaggaatacgggtagctgaggtt
atccgttcggaagattccagcgccgtaggtgaaaccgcatccgatgtctatgagtcttcc
ccaccatccggcaccctgatcgatagctcccaaaccgcagtaaccattgtgttggttggc
gaagttgaagtgcccaatgtagtaggaaaacgcctaagtgaagcacgtcgtatcttgcac
gatgcaggtttggaggcaaaggtggcaacgtcggcaagcaatagcagccgagtgttatac
cagtctcctacaatattcagcacgttagcgcccggcgaagaagtagaattacgtgtcctt
aattaa

DBGET integrated database retrieval system