KEGG   Cronobacter muytjensii: AFK63_06930Help
Entry
AFK63_06930       CDS       T04067                                 

Definition
(GenBank) linoleoyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00591  Linoleic acid metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    AFK63_06930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmw01004]
    AFK63_06930
Enzymes [BR:cmw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     AFK63_06930
Lipid biosynthesis proteins [BR:cmw01004]
 Desaturase
  Front-end
   AFK63_06930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ALB70352
LinkDB All DBs
Position
1484815..1485915
Genome map
AA seq 366 aa AA seqDB search
MSHNSPPRAEGRDRALHKAFRTACQRYLAARRDHRFADRGMWLKLAFLTLGCALCYLLCL
SRSDLSGYALCYFGFIFFAMMLVVNVLHDASHNAFCRTAAANAWLGRVISLPLGLDADSW
QVRHVQFHHPYTNIQGYDPDIEENGVLCQTPFQRWKPVMRFQHLYWPLVAALTFPWYAWW
MDWRDRLGNTPFTCHLPRQGAGGAGLFLLLKGAHFLLALGVPALCMAGQIPFITLLCVYL
ASQMLVSALFVSLLIGTHWAKGHFYPTPEKNAVSQSPYHHAFATTFDWGAKPRLLGYWLG
GLNLHLTHHLFPDWSHRHFSALSAIIGDVAREHGLTYQILSVRDLLRLQRRHLKRMGVKP
EKNRRR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataactcgccgccgcgcgcggaaggccgcgaccgggcgctgcataaggcgttt
cgcaccgcctgccagcgctacctggcggcgcggcgcgatcaccggttcgccgacagggga
atgtggttaaagctcgcgtttctcacgctgggttgtgcgctgtgctatctgttgtgcctc
tcccggtcggaccttagcggttacgcgctctgctatttcgggtttatctttttcgccatg
atgctggtggtgaatgtgctgcacgacgccagccataacgcgttttgccgcactgcggcg
gcgaacgcctggcttggccgcgttatcagcctgccgctgggccttgatgctgatagctgg
caggtgcggcacgtacagtttcatcacccgtacaccaatattcagggctacgacccggat
atcgaagagaatggcgtgctctgccagacgccgtttcagcgctggaaacctgtcatgcgc
tttcagcatctttactggccgctggtggcggcgctgacattcccgtggtacgcctggtgg
atggactggcgcgaccggcttggcaacacgcctttcacatgtcatttgccccggcagggc
gcgggtggcgcggggctgtttctgctgctgaaaggcgcgcattttctgctggcgctgggc
gtgccggcgctgtgcatggctggtcagatcccgttcatcaccctgttgtgcgtttatctg
gcaagccagatgctggtctcagcgctgtttgtctcgctgcttatcggcactcactgggcg
aaaggccacttttacccgacgccggaaaaaaacgcggtgtcgcaaagtccctatcatcac
gcgttcgccacgacctttgactggggcgcaaagccgcggctgctgggctactggctcggc
gggctgaatttgcacctgacgcatcatctgtttcccgactggagccaccgtcatttttcg
gcgttgagcgctatcatcggcgacgtagcgcgcgaacacgggctgacgtatcagatcttg
tcggtgcgtgatctgctgcggttgcagcggcggcatttaaagcggatgggcgtgaaaccg
gagaaaaaccgccgccggtaa

DBGET integrated database retrieval system