KEGG   Cronobacter muytjensii: AFK63_09030Help
Entry
AFK63_09030       CDS       T04067                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00500  Starch and sucrose metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFK63_09030
Enzymes [BR:cmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AFK63_09030
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AFK63_09030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ALB70744
UniProt: A0A0K2PD89
LinkDB All DBs
Position
1935413..1937017
Genome map
AA seq 534 aa AA seqDB search
MSRLWHQNAVIYQIDPTRFFDSNADGWGDLRGIVEKLDYVESLGATAIWLTPFYLSPRRD
NGYDVENHTEPDPRIGSLEDVEWLIAEAGKRNIRVIIELVAQHTSNEHNWFLEARKGRDS
PFHDFYLWRDTPGPDEPAPMFPTVEPHIWRFDEQAQRYYRHLFYHHEPDLNLRHPDVIQA
VDHVLRFWADKGVAGFRVDAASHMVEQASLPGDRESGYRLFNHFYDLLTADHPDMILLGE
VDVNVSEFEDFFGGGERLTTLLNFWINKNTILALAREAAAPLVKALNELPMPPANGGYCF
WLRNHDELDLEDLEPEDYDFVMEKYAPDPDMRIYGRGIRRRLAPMLGGDERHQAMAHALL
FSLPGTPVVRYGAEIGMGDLLSQPERESVRTPMQWHPGTGAGFSACDPARFVEPLIAEGP
FRYQVVNVEEQEARAGSLLHRIREIIAVWRTLPEICYQHFHPFTVREKSVFAVRYQNHNV
ATLMLTNLSHAPVTVDLGELDLTDAREILADDDYPPVACELRINGYGYRWLRMR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctgtggcaccagaacgccgtcatctaccagatcgatcctacccgttttttt
gacagcaacgccgacggctggggagacctgcgcggcattgttgaaaagctcgactatgtc
gaatcgcttggcgcgaccgccatctggctgaccccgttttatctctcgccgcgacgcgat
aacggttatgacgtggaaaaccatacggaacccgacccacgcatcggctcgctggaagat
gtcgagtggctgattgccgaagcgggcaaacgcaatatccgggtgattatcgaactggtg
gcgcagcatacgtccaatgagcacaactggtttctggaggcgcgcaagggccgcgacagc
ccgtttcacgacttctatctctggcgcgacacgccggggccggatgagcctgcgccgatg
tttcctaccgtcgagccgcatatctggcgctttgatgaacaggcgcagcgctactatcgg
cacctcttttaccatcacgaaccggatctcaacctgcgccacccggatgttatccaggca
gtcgatcacgtgctgcgcttctgggctgataaaggtgtggctggctttcgcgtcgacgcg
gcctcgcacatggtggaacaggcgagcctgcctggcgaccgcgagagcggctaccggctc
tttaaccacttctacgatctgctgaccgccgaccacccggatatgatcctgcttggcgaa
gtggacgtgaacgtctcagaatttgaagatttcttcggcggcggcgagcgactcaccacg
ctgctgaacttctggataaacaaaaacacgattctggcgctggcccgcgaagcggccgcg
ccgctggtgaaagcgctcaacgaactgcccatgccgcctgccaacggcggctactgtttc
tggctgcgcaaccatgacgagctggaccttgaagatctggagcctgaagattacgacttc
gtgatggagaaatacgccccggacccggatatgcgtatctacgggcgtgggatccgtcgc
cgcctggcgccaatgctcggtggcgatgagcgtcatcaggcgatggcgcatgccctgctg
ttttcactgccgggcacgccagtggtgcgctacggcgcggaaatcggcatgggggatctg
ctttcacagccggagcgggaatcggtacgcacgccgatgcagtggcatcccggaactggt
gccgggttttcggcctgcgatccggcgaggtttgtggagccgctcatcgcagaggggccg
tttcgctatcaggtggtgaacgtcgaagaacaagaggcgcgcgcgggctcattactgcac
cgtatccgcgagattatcgcagtctggcgcaccctgccggagatctgctatcagcacttt
cacccgttcacggtacgggaaaagagcgtcttcgcggtacgctaccagaatcacaacgtc
gccacgctgatgctcactaatctgagccatgcgccggtgacggtggatttaggcgagctg
gatttaacggacgcccgcgagatcctggcggatgatgattatccgccagtcgcctgcgag
cttcgcatcaacggttacggctaccgctggctgcgaatgcgctag

DBGET integrated database retrieval system