KEGG   Cronobacter muytjensii: AFK63_09375
Entry
AFK63_09375       CDS       T04067                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK63_09375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmw01001]
    AFK63_09375
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cmw02022]
    AFK63_09375
Enzymes [BR:cmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AFK63_09375
Protein kinases [BR:cmw01001]
 Histidine kinases
  OmpR family
   AFK63_09375
Two-component system [BR:cmw02022]
 OmpR family
  RstB-RstA
   AFK63_09375
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: ALB70810
LinkDB
Position
2015004..2016290
AA seq 428 aa
MKKLFIQFYLLLFVCFLVMTMLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPH
EWNKTIKELDLNLSFKLRIQPLSQFHLDDINSRRLREGEIVALDDEYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDIALIALIAISLALPVFIWMRPHWQEMLRLEAAAQRLGDGHLD
ERIHFDKASGFARLGVAFNQMANNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDIGQLEALIEELLTYARLDRPQTELHLTHPALSRWLHEYVDDARSLHPER
ELVLARVDEGDYGALDMRLMERVLDNLVNNGLRYSEQRLRIGLSLQGAQATLEVEDDGPG
IPEAERSRVFEPFVRLDPSRDRATGGCGLGLAIVQSIATAMSGQVSVAQSTLGGAHFRFS
WPVVPDDA
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaaaaactctttatccagttctatttgctgctgtttgtctgctttctggtgatgacg
atgctggtcgggctggtctataaattcaccgccgaacgcgcgggccgccagtcgctggac
gacctgatgaaaagctcgctctacctgatgcgcagcgagctgcgggaaattccgccgcat
gaatggaacaaaaccattaaagaactggatttaaacctgtcgtttaagctgcggatccag
ccgctcagccagtttcatctcgatgacatcaacagccgccgtctgcgcgagggcgaaatt
gtggcgctggacgatgaatatacgtttatccagcgtattccgcgcagccactacgtgctc
gccgtcggcccggtgccgtatctctattttctgcatcagatgcggctgctggatatcgcg
ctgattgcgctgattgcgatttcgctggcgctgccggtgtttatctggatgcggccccac
tggcaggagatgttgcgcctggaggcggcggcgcagcggctcggcgacggacaccttgat
gaacgcattcattttgataaagcctcgggcttcgcgcggctcggcgtggcgttcaaccag
atggcgaataacattaacgcgctgattgccagcaaaaaacagcttattgacggcatcgct
catgaactgcgcactccactggtgcggctgcgctaccggctggagatgagcgataacctg
agcgcggcggagtcgcaggcgctaaaccgcgatatcggtcagctcgaagcgctcattgag
gagcttttgacctatgcgcgactcgaccgcccgcaaacggaactgcacctgacgcacccg
gcgctgtcccgctggctgcatgagtatgtcgatgacgcgcgctcgctgcacccggaacgc
gagctggtgctggctcgcgttgatgaaggcgattacggcgcgctcgatatgcgcctgatg
gagcgcgtgctggataatctggtgaataacgggctgcgttacagcgaacagcggctgagg
atcgggttatcgctgcagggcgcgcaggcgacgcttgaagtggaagacgacggccccggc
attccggaagcagaacgcagccgggtattcgagccgtttgtgcgtctcgacccgagccgc
gatcgcgctacgggcggctgcggcctcgggctcgccatcgtacagtcgatcgccaccgcg
atgagcggccaggtgagcgtcgcgcagagcacgctcggcggcgcgcattttcgtttcagt
tggccagtagtgcctgatgacgcgtaa

DBGET integrated database retrieval system